<?xml version="1.0" encoding="UTF-8"?><!DOCTYPE article PUBLIC "-//NLM//DTD JATS (Z39.96) Journal Publishing DTD v1.2 20190208//EN" "http://jats.nlm.nih.gov/publishing/1.2/JATS-journalpublishing1.dtd"><article xmlns:mml="http://www.w3.org/1998/Math/MathML" xmlns:xlink="http://www.w3.org/1999/xlink" article-type="research-article" dtd-version="1.2" xml:lang="en">
    <front>
        <journal-meta>
            <journal-id journal-id-type="pmc">F1000Research</journal-id>
            <journal-title-group>
                <journal-title>F1000Research</journal-title>
            </journal-title-group>
            <issn pub-type="epub">2046-1402</issn>
            <publisher>
                <publisher-name>F1000 Research Limited</publisher-name>
                <publisher-loc>London, UK</publisher-loc>
            </publisher>
        </journal-meta>
        <article-meta>
            <article-id pub-id-type="doi">10.12688/f1000research.142843.1</article-id>
            <article-categories>
                <subj-group subj-group-type="heading">
                    <subject>Research Article</subject>
                </subj-group>
                <subj-group>
                    <subject>Articles</subject>
                </subj-group>
            </article-categories>
            <title-group>
                <article-title>In silico analysis of molecular mimicry between human aquaporin 3, 
                    <italic>Aspergillus fumigatus</italic> aquaporin and aquaporins from allergic sources</article-title>
                <fn-group content-type="pub-status">
                    <fn>
                        <p>[version 1; peer review: 1 approved, 1 approved with reservations]</p>
                    </fn>
                </fn-group>
            </title-group>
            <contrib-group>
                <contrib contrib-type="author" corresp="yes">
                    <name>
                        <surname>S&#x00e1;nchez</surname>
                        <given-names>Andr&#x00e9;s</given-names>
                    </name>
                    <role content-type="http://credit.niso.org/">Conceptualization</role>
                    <role content-type="http://credit.niso.org/">Data Curation</role>
                    <role content-type="http://credit.niso.org/">Formal Analysis</role>
                    <role content-type="http://credit.niso.org/">Investigation</role>
                    <role content-type="http://credit.niso.org/">Methodology</role>
                    <role content-type="http://credit.niso.org/">Supervision</role>
                    <role content-type="http://credit.niso.org/">Writing &#x2013; Original Draft Preparation</role>
                    <role content-type="http://credit.niso.org/">Writing &#x2013; Review &amp; Editing</role>
                    <uri content-type="orcid">https://orcid.org/0000-0001-7460-3427</uri>
                    <xref ref-type="corresp" rid="c1">a</xref>
                    <xref ref-type="aff" rid="a1">1</xref>
                    <xref ref-type="aff" rid="a2">2</xref>
                    <xref ref-type="aff" rid="a3">3</xref>
                </contrib>
                <contrib contrib-type="author" corresp="no">
                    <name>
                        <surname>Padilla</surname>
                        <given-names>Yaquelin</given-names>
                    </name>
                    <role content-type="http://credit.niso.org/">Conceptualization</role>
                    <role content-type="http://credit.niso.org/">Data Curation</role>
                    <role content-type="http://credit.niso.org/">Formal Analysis</role>
                    <role content-type="http://credit.niso.org/">Software</role>
                    <role content-type="http://credit.niso.org/">Writing &#x2013; Original Draft Preparation</role>
                    <role content-type="http://credit.niso.org/">Writing &#x2013; Review &amp; Editing</role>
                    <xref ref-type="aff" rid="a1">1</xref>
                </contrib>
                <contrib contrib-type="author" corresp="no">
                    <name>
                        <surname>Lorduy</surname>
                        <given-names>Adriana</given-names>
                    </name>
                    <role content-type="http://credit.niso.org/">Conceptualization</role>
                    <role content-type="http://credit.niso.org/">Data Curation</role>
                    <role content-type="http://credit.niso.org/">Formal Analysis</role>
                    <role content-type="http://credit.niso.org/">Methodology</role>
                    <role content-type="http://credit.niso.org/">Software</role>
                    <role content-type="http://credit.niso.org/">Writing &#x2013; Original Draft Preparation</role>
                    <role content-type="http://credit.niso.org/">Writing &#x2013; Review &amp; Editing</role>
                    <xref ref-type="aff" rid="a1">1</xref>
                </contrib>
                <contrib contrib-type="author" corresp="no">
                    <name>
                        <surname>Sanchez</surname>
                        <given-names>Jorge</given-names>
                    </name>
                    <role content-type="http://credit.niso.org/">Conceptualization</role>
                    <role content-type="http://credit.niso.org/">Data Curation</role>
                    <role content-type="http://credit.niso.org/">Methodology</role>
                    <role content-type="http://credit.niso.org/">Software</role>
                    <role content-type="http://credit.niso.org/">Supervision</role>
                    <role content-type="http://credit.niso.org/">Validation</role>
                    <role content-type="http://credit.niso.org/">Visualization</role>
                    <xref ref-type="aff" rid="a2">2</xref>
                </contrib>
                <contrib contrib-type="author" corresp="no">
                    <name>
                        <surname>Munera</surname>
                        <given-names>Marlon</given-names>
                    </name>
                    <role content-type="http://credit.niso.org/">Conceptualization</role>
                    <role content-type="http://credit.niso.org/">Data Curation</role>
                    <role content-type="http://credit.niso.org/">Formal Analysis</role>
                    <role content-type="http://credit.niso.org/">Methodology</role>
                    <role content-type="http://credit.niso.org/">Supervision</role>
                    <role content-type="http://credit.niso.org/">Validation</role>
                    <role content-type="http://credit.niso.org/">Visualization</role>
                    <uri content-type="orcid">https://orcid.org/0000-0003-3428-0541</uri>
                    <xref ref-type="aff" rid="a3">3</xref>
                </contrib>
                <contrib contrib-type="author" corresp="no">
                    <name>
                        <surname>Baena</surname>
                        <given-names>Claudia</given-names>
                    </name>
                    <role content-type="http://credit.niso.org/">Data Curation</role>
                    <role content-type="http://credit.niso.org/">Formal Analysis</role>
                    <role content-type="http://credit.niso.org/">Methodology</role>
                    <role content-type="http://credit.niso.org/">Software</role>
                    <role content-type="http://credit.niso.org/">Validation</role>
                    <role content-type="http://credit.niso.org/">Writing &#x2013; Review &amp; Editing</role>
                    <uri content-type="orcid">https://orcid.org/0000-0001-7196-2694</uri>
                    <xref ref-type="aff" rid="a1">1</xref>
                </contrib>
                <contrib contrib-type="author" corresp="no">
                    <name>
                        <surname>Bernal</surname>
                        <given-names>Carlos</given-names>
                    </name>
                    <role content-type="http://credit.niso.org/">Conceptualization</role>
                    <role content-type="http://credit.niso.org/">Investigation</role>
                    <role content-type="http://credit.niso.org/">Methodology</role>
                    <role content-type="http://credit.niso.org/">Software</role>
                    <role content-type="http://credit.niso.org/">Supervision</role>
                    <role content-type="http://credit.niso.org/">Validation</role>
                    <role content-type="http://credit.niso.org/">Visualization</role>
                    <uri content-type="orcid">https://orcid.org/0000-0001-8681-5777</uri>
                    <xref ref-type="aff" rid="a1">1</xref>
                </contrib>
                <contrib contrib-type="author" corresp="no">
                    <name>
                        <surname>Urrego</surname>
                        <given-names>Juan</given-names>
                    </name>
                    <role content-type="http://credit.niso.org/">Conceptualization</role>
                    <role content-type="http://credit.niso.org/">Investigation</role>
                    <role content-type="http://credit.niso.org/">Methodology</role>
                    <role content-type="http://credit.niso.org/">Supervision</role>
                    <role content-type="http://credit.niso.org/">Validation</role>
                    <role content-type="http://credit.niso.org/">Visualization</role>
                    <role content-type="http://credit.niso.org/">Writing &#x2013; Review &amp; Editing</role>
                    <uri content-type="orcid">https://orcid.org/0000-0002-1388-8227</uri>
                    <xref ref-type="aff" rid="a1">1</xref>
                </contrib>
                <aff id="a1">
                    <label>1</label>Research Group of Pharmaceutical, Cosmetic, and Food Technology (GIFTCA), University of Cartagena, Cartagena, Bol&#x00ed;var, Colombia</aff>
                <aff id="a2">
                    <label>2</label>Clinical and Experimental Allergy Group (GACE), University of Antioquia, Medell&#x00ed;n, Antioquia, Colombia</aff>
                <aff id="a3">
                    <label>3</label>Group of Research Medicine (GINUMED), Rafael Nunez University Corporation, Cartagena, Bol&#x00ed;var, Colombia</aff>
            </contrib-group>
            <author-notes>
                <corresp id="c1">
                    <label>a</label>
                    <email xlink:href="mailto:andres.sanchez@curnvirtual.edu.co">andres.sanchez@curnvirtual.edu.co</email>
                </corresp>
                <fn fn-type="conflict">
                    <p>No competing interests were disclosed.</p>
                </fn>
            </author-notes>
            <pub-date pub-type="epub">
                <day>23</day>
                <month>4</month>
                <year>2024</year>
            </pub-date>
            <pub-date pub-type="collection">
                <year>2024</year>
            </pub-date>
            <volume>13</volume>
            <elocation-id>358</elocation-id>
            <history>
                <date date-type="accepted">
                    <day>10</day>
                    <month>4</month>
                    <year>2024</year>
                </date>
            </history>
            <permissions>
                <copyright-statement>Copyright: &#x00a9; 2024 S&#x00e1;nchez A et al.</copyright-statement>
                <copyright-year>2024</copyright-year>
                <license xlink:href="https://creativecommons.org/licenses/by/4.0/">
                    <license-p>This is an open access article distributed under the terms of the Creative Commons Attribution Licence, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.</license-p>
                </license>
                <license>
                    <license-p>The author(s) is/are employees of the US Government and therefore domestic copyright protection in USA does not apply to this work. The work may be protected under the copyright laws of other jurisdictions when used in those jurisdictions.</license-p>
                </license>
            </permissions>
            <self-uri content-type="pdf" xlink:href="https://f1000research.com/articles/13-358/pdf"/>
            <abstract>
                <sec>
                    <title>Background</title>
                    <p>Atopic dermatitis (AD) is a chronic inflammatory skin condition that has a significant impact on quality of life. The immune response and allergy symptoms in AD are triggered by the recognition of specific allergens by IgE antibodies. Cross-reactivity can lead to auto-IgE responses, potentially worsening AD symptoms. Our research aimed to enhance our understanding of allergenic sources, including A. fumigatus, and their role in AD. We focused on molecular mimicry between human AQP3 and A. fumigatus aquaporin.</p>
                </sec>
                <sec>
                    <title>Methods</title>
                    <p>In our in-silico analysis, we compared the amino acid sequences of human aquaporin 3 (AQP3) and A. fumigatus aquaporin with 25 aquaporins from various allergenic sources, sourced from the UniProt and NCBI databases. Phylogenetic relationship analysis and homology-based modeling were conducted. We identified conserved antigenic regions located within the 3D structures.</p>
                </sec>
                <sec>
                    <title>Results</title>
                    <p>The global identity levels among the studied aquaporins averaged 32.6%. One antigenic site exhibited a remarkable local region, with a conserved identity of 71.4%. We categorized the aquaporins into five monophyletic clades (A&#x2013;E), with group B showing the highest identity (95%), including six mammalian aquaporins, including AQP3. When comparing 
                        <italic toggle="yes">A. fumigatus</italic> aquaporins, the highest identity was observed with 
                        <italic toggle="yes">Malassezia sympodialis</italic> at 35%. Both human and A. fumigatus aquaporins have three linear and three discontinuous epitopes.</p>
                </sec>
                <sec>
                    <title>Conclusions</title>
                    <p>We identified potential linear and conformational epitopes of AQP3, indicating a possible molecular mimicry between humans and 
                        <italic toggle="yes">A. fumigatus</italic> aquaporins. This suggests autoreactivity and potential cross-reactivity, although further validation using in vitro and in vivo experiments is required.</p>
                </sec>
            </abstract>
            <kwd-group kwd-group-type="author">
                <kwd>Atopic dermatitis</kwd>
                <kwd>in silico</kwd>
                <kwd>molecular mimicry</kwd>
                <kwd>Aspergillus fumigatus</kwd>
                <kwd>aquaporins.</kwd>
            </kwd-group>
            <funding-group>
                <funding-statement>The author(s) declared that no grants were involved in supporting this work.</funding-statement>
            </funding-group>
        </article-meta>
    </front>
    <body>
        <sec id="sec5" sec-type="intro">
            <title>Introduction</title>
            <p>Atopic dermatitis (AD) is a chronic and recurrent inflammatory skin disorder characterized by symptoms, such as eczema, erythema, persistent itching, and continuous skin damage. Over the past 30 years, the prevalence of AD has shown a notable rise, affecting between 5% and 20% of the child population and approximately 7% of adults in industrialized countries.
                <sup>
                    <xref ref-type="bibr" rid="ref1">1</xref>
                </sup>
                <sup>,</sup>
                <sup>
                    <xref ref-type="bibr" rid="ref2">2</xref>
                </sup> The pathogenesis of AD is not completely clear; however, allergens can activate an intense Th2 response.
                <sup>
                    <xref ref-type="bibr" rid="ref3">3</xref>
                </sup> Allergenic sources can vary depending on the population; for example, house dust mites are the main source of sensitization in tropical countries, whereas in Europe, pollen is the main trigger for allergies. In addition, depending on the environmental conditions, it is possible to be exposed to different species; therefore, epidemiological studies have shown variations in the frequencies of sensitization.
                <sup>
                    <xref ref-type="bibr" rid="ref4">4</xref>
                </sup> The severity of the disease is influenced by several factors, including compromised skin barrier integrity due to reduced levels of filaggrins and ceramides as well as an elevated presence of water channels such as aquaporin, which drives the skin, making the patient more susceptible to atopic dermatitis.
                <sup>
                    <xref ref-type="bibr" rid="ref5">5</xref>
                </sup> In general, allergy management includes allergen avoidance, pharmacotherapy, and immunotherapy, where only the latter has a beneficial effect that lasts for years and allows for a reduction in anti-inflammatory treatment.
                <sup>
                    <xref ref-type="bibr" rid="ref6">6</xref>
                </sup>
                <sup>&#x2013;</sup>
                <sup>
                    <xref ref-type="bibr" rid="ref8">8</xref>
                </sup>
            </p>
            <p>In addition to other environmental factors, the skin microbiome plays a pivotal role in AD development. 
                <italic toggle="yes">Aspergillus fumigatus</italic> is an opportunistic pathogen in both poikilothermic and homeothermic animals. In humans, this pathogen has been associated with many pathologies such as invasive cutaneous aspergillosis, saprophytic lung colonization, and aspergillomas. In addition, 
                <italic toggle="yes">A. fumigatus</italic> can induce IgE-mediated allergic diseases including rhinitis, allergic sinusitis, asthma, hypersensitivity pneumonitis, and AD.
                <sup>
                    <xref ref-type="bibr" rid="ref9">9</xref>
                </sup>
                <sup>,</sup>
                <sup>
                    <xref ref-type="bibr" rid="ref10">10</xref>
                </sup> It has been characterized as an important allergenic source, and some allergens, including thioredoxins and cyclophilins, share homology with human proteins and are implicated in the autoreactive response in AD.</p>
            <p>Despite the identification of sensitization to extracts from allergenic sources, such as fungi, the recognition of specific IgE sensitization to allergens is necessary to carry out a better diagnosis and immunotherapy.
                <sup>
                    <xref ref-type="bibr" rid="ref11">11</xref>
                </sup> However, this represents a challenge, because most fungal allergens cross-react with other taxonomically distant species, making it difficult to prove the clinical relevance of IgE reactivity against these allergens. In addition, it is important to consider that the evolution of AD varies greatly among patients with this disease and can be triggered by different factors. For example, in 
                <italic toggle="yes">A. fumigatus</italic> and AD, studies suggest that specific IgE-mediated activation is induced not by multiple allergens and not by a few major allergens, as is the case with asthma and rhinitis.
                <sup>
                    <xref ref-type="bibr" rid="ref12">12</xref>
                </sup>
                <sup>,</sup>
                <sup>
                    <xref ref-type="bibr" rid="ref13">13</xref>
                </sup> Another problem presented by the diagnosis of allergic diseases associated with 
                <italic toggle="yes">A. fumigatus</italic> is the lack of standardized allergens for preparation of molecular component tests. Therefore, the discovery of new fungal allergens and the identification of the prevalence of these new components may provide an opportunity to learn more about the pathology of atopic dermatitis, improving the diagnosis and treatment of this disease.</p>
            <p>In recent years, aquaporin has become a candidate protein for the study of skin and allergic diseases such as AD, given its role in epidermal hydration and the transport of various substances such as glycerol, salts, and exocrine fluids, favoring dry skin and allergen leakage.
                <sup>
                    <xref ref-type="bibr" rid="ref14">14</xref>
                </sup> They have also been associated with various atopic diseases, such as glaucoma, cancer, epilepsy, obesity, epidermal hyperplasia, and neuromyelitis optical, among others. In AD, an increase in the expression of aquaporin 3 has been observed, which may be related to water loss and the severity of the disease, in contrast to healthy individuals who maintain a balanced expression of this protein in the basal, horny, and spinous layers.
                <sup>
                    <xref ref-type="bibr" rid="ref5">5</xref>
                </sup> The consequences of aquaporin 3 (AQP3) overexpression extend beyond cutaneous water retention as it becomes a target for the exacerbated immune response in AD inflammation. This hypothesis suggests that it may be recognized by human autoantibodies, which, due to the persistence of self-protein exposure, contribute to increased inflammation and chronicity of AD.</p>
            <p>Additionally, this protein is present in most organisms with a wide variety of isoforms and functions throughout the taxonomic framework. Recently, aquaporin has been identified in highly allergenic species, such as house dust mites. In a study carried out by Mao 
                <italic toggle="yes">et al.,</italic> describing the 
                <italic toggle="yes">Dermatophagoides farinae</italic> proteome, two-dimensional immunoblotting was performed, which showed binding with IgE antibodies in a band that has the same isoelectric point and molecular weight of the aquaporin family, suggesting its possible role as an allergen. The objective of this study was to perform an 
                <italic toggle="yes">in silico</italic> analysis to investigate the potential molecular mimicry between human aquaporins and those from 
                <italic toggle="yes">A. fumigatus</italic>, as well as various allergenic sources.</p>
        </sec>
        <sec id="sec6" sec-type="methods">
            <title>Methods</title>
            <p>For the selection of aquaporins, the 
                <italic toggle="yes">Aspergillus fumigatus</italic> (KEY82230) and human aquaporin 3 (Q92482) sequences of interest were compared with existing allergenic protein sequences using Allermatch (
                <ext-link ext-link-type="uri" xlink:href="https://allermatch.org/">https://allermatch.org/</ext-link>), an allergen comparative server that allows allergen sequence alignment; therefore, those with high identity values were chosen. The sequence pool was obtained from the UniProt (
                <ext-link ext-link-type="uri" xlink:href="https://www.uniprot.org/">https://www.uniprot.org/</ext-link>) and National Center for Biotechnology Information (NCBI) databases. Given the diversity in amino acid origins and lengths across the molecules under examination, we employed coverage and identity values to gauge the extent of their relationships. The identity and coverage values between the molecules used in this study were determined using the EMBOSS Needle (
                <ext-link ext-link-type="uri" xlink:href="https://www.ebi.ac.uk/Tools/psa/emboss_needle/">https://www.ebi.ac.uk/Tools/psa/emboss_needle/</ext-link>), specialized for performing paired alignments, and the web server from Praline (
                <ext-link ext-link-type="uri" xlink:href="http://www.ibi.vu.nl/">http://www.ibi.vu.nl/</ext-link>), which allowed for paired and multiple alignments. When carrying out the alignment, it was considered that the sequences were different and came from different sources; therefore, the alignment parameters were set to utilize the BLOSUM62 matrix, which primarily assesses evolutionary divergence, along with adjustments to the conditional scoring matrix.
                <sup>
                    <xref ref-type="bibr" rid="ref15">15</xref>
                </sup>
                <sup>,</sup>
                <sup>
                    <xref ref-type="bibr" rid="ref16">16</xref>
                </sup>
            </p>
            <sec id="sec7">
                <title>Phylogenetic analysis</title>
                <p>To construct the phylogenetic tree, we conducted a study using &#x201c;Molecular Evolutionary Genetic Analysis&#x201d; (MEGA) version 11 program. We employed the neighbor-joining (R) reconstruction method, supported by 100 bootstrap repetitions, to ensure the reliability and robustness of the analysis. Evolutionary distances were computed using the Poisson correction method, which uses a comparison matrix to identify sequence similarities. This matrix was created based on all amino acid sequences of the selected allergens, with all empty gaps removed (full deletions). Branch length summation (SBL) was presented as a measure of overall comparison and homologies, providing insights into the number of nodes, their positions, and the formation of the evolutionarily closest sequence &#x201c;clusters.
                    <sup>
                        <xref ref-type="bibr" rid="ref15">15</xref>
                    </sup>
                    <sup>,</sup>
                    <sup>
                        <xref ref-type="bibr" rid="ref17">17</xref>
                    </sup>
                </p>
            </sec>
            <sec id="sec8">
                <title>3D models of proteins</title>
                <p>Aquaporin models were acquired from the Protein Data Bank and AlphaFold (
                    <italic toggle="yes">Homo sapiens, Felis catus, Equus caballus, Bos taurus, Mus musculus, Malassezia sympodialis, Saccharomyces cerevisiae, Penicillium chrysogenum, Escherichia coli</italic>). For 
                    <italic toggle="yes">A. fumigatus</italic> and 
                    <italic toggle="yes">Cannis lupus familiaris</italic> aquaporin 3D structures were modeled by homology using the Swiss Model server (
                    <ext-link ext-link-type="uri" xlink:href="https://swissmodel.expasy.org/">https://swissmodel.expasy.org/</ext-link>), and these models were refined in ModRefiner. (
                    <ext-link ext-link-type="uri" xlink:href="https://zhanggroup.org/ModRefiner/">https://zhanggroup.org/ModRefiner/</ext-link>), an algorithm for the fine-grained refinement of protein structures at the atomic level.
                    <sup>
                        <xref ref-type="bibr" rid="ref18">18</xref>
                    </sup>
                </p>
            </sec>
            <sec id="sec9">
                <title>Epitope prediction</title>
                <p>Models were used to locate possible epitope regions predicted by the Ellipro server (
                    <ext-link ext-link-type="uri" xlink:href="http://tools.iedb.org/ellipro/">http://tools.iedb.org/ellipro/</ext-link>), which was used to predict linear and discontinuous epitopes in the aquaporins of 
                    <italic toggle="yes">A. fumigatus</italic>, (AQP3), 
                    <italic toggle="yes">Cannis lupus familiaris, Felis catus, Equus caballus, Bos taurus, Mus musculus, Malassezia sympodialis, Saccharomyces cerevisiae, Penicillium chrysogenum</italic> and 
                    <italic toggle="yes">Escherichia coli.</italic> The potential epitopes were selected under the criteria of a score &#x2265; 7, as this value evaluates how exposed the residue is and the binding capacity of the epitope with the paratope.
                    <sup>
                        <xref ref-type="bibr" rid="ref15">15</xref>
                    </sup>
                    <sup>,</sup>
                    <sup>
                        <xref ref-type="bibr" rid="ref17">17</xref>
                    </sup>
                </p>
            </sec>
            <sec id="sec10">
                <title>Identification of aquaporin domains</title>
                <p>The characterization of the protein domains was carried out using the Interpro web server (
                    <ext-link ext-link-type="uri" xlink:href="https://www.ebi.ac.uk/interpro/">https://www.ebi.ac.uk/interpro/</ext-link>); with this bioinformatic tool we obtained those domains with functional activity present in the protein sequence of the aquaporins studied. Subsequently, a review of the tertiary structure was carried out using the PyMOL program, which functioned as a molecular viewer, allowing identification of the location of the protein domains in the tertiary structure of each one.</p>
            </sec>
        </sec>
        <sec id="sec11" sec-type="results">
            <title>Results</title>
            <sec id="sec12">
                <title>Aquaporins sequence alignments</title>
                <p>A total of 25 aquaporin sequences from different sources were selected and compared with the 
                    <italic toggle="yes">A. fumigatus</italic> aquaporin and human aquaporin (
                    <xref ref-type="table" rid="T1">Table 1</xref>), the identity percentages of the aquaporins from different sources Vs 
                    <italic toggle="yes">A. fumigatus</italic> aquaporin and AQP3 are shown in 
                    <xref ref-type="table" rid="T2">Table 2</xref>. Notably, human AQP3 exhibited maximum values of identity and similarity of 95.5% and 98.6%, respectively, with aquaporin allergy sources. When comparing 
                    <italic toggle="yes">A. fumigatus</italic> aquaporins and AQP3, an identity of 32.6% and a similarity of 47.5% were observed, indicating a significant degree of homology between them. Regarding the AQP of 
                    <italic toggle="yes">A. fumigatus</italic>, the highest identity values were observed in the AQP of 
                    <italic toggle="yes">M. simpodialies</italic> (35%), followed by the mammalian species that also had greater identity with human AQP3, such as 
                    <italic toggle="yes">C. familiaris</italic> (33, 9%), 
                    <italic toggle="yes">Felis gatus</italic> (33, 10%), 
                    <italic toggle="yes">Mus musculus</italic> (33, 10%), and Bos taurus (32, 80%). The lowest identity and similarity results were obtained with apple (
                    <italic toggle="yes">Malus domestica</italic>), with values of 0.2% and 0.9%, respectively.</p>
                <table-wrap id="T1" orientation="portrait" position="float">
                    <label>Table 1. </label>
                    <caption>
                        <title>Aquaporins studies.</title>
                    </caption>
                    <table content-type="article-table" frame="hsides">
                        <thead>
                            <tr>
                                <th align="left" colspan="1" rowspan="1" valign="top">Organisms</th>
                                <th align="left" colspan="1" rowspan="1" valign="top">Protein</th>
                                <th align="left" colspan="1" rowspan="1" valign="top">Uniprot/NCBI Entry</th>
                                <th align="left" colspan="1" rowspan="1" valign="top">Amino&#x00e1;cidos</th>
                            </tr>
                        </thead>
                        <tbody>
                            <tr>
                                <td align="left" colspan="1" rowspan="1" valign="middle">
                                    <italic toggle="yes">Aspergillus fumigatus</italic>
                                </td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">aquaglyceroporin</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">
                                    <ext-link ext-link-type="uri" xlink:href="https://www.ncbi.nlm.nih.gov/protein/KEY82230.1">KEY82230</ext-link>
                                </td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">335</td>
                            </tr>
                            <tr>
                                <td align="left" colspan="1" rowspan="1" valign="middle">
                                    <italic toggle="yes">Homo sapiens</italic>
                                </td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">Aquaporin-3</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">
                                    <ext-link ext-link-type="uri" xlink:href="https://www.uniprot.org/uniprotkb/Q92482/entry">Q92482</ext-link>
                                </td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">292</td>
                            </tr>
                            <tr>
                                <td align="left" colspan="1" rowspan="1" valign="middle">
                                    <italic toggle="yes">Dermatophagoides pteronyssinus</italic>
                                </td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">Aquaporin</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">
                                    <ext-link ext-link-type="uri" xlink:href="https://www.uniprot.org/uniprotkb/A0A2D1VL80/entry">A0A2D1VL80</ext-link>
                                </td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">265</td>
                            </tr>
                            <tr>
                                <td align="left" colspan="1" rowspan="1" valign="middle">
                                    <italic toggle="yes">Dermatophagoides farinae</italic>
                                </td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">Aquaporin</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">
                                    <ext-link ext-link-type="uri" xlink:href="https://www.uniprot.org/uniprotkb/A0A2C9PGE6/entry">A0A2C9PGE6</ext-link>
                                </td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">259</td>
                            </tr>
                            <tr>
                                <td align="left" colspan="1" rowspan="1" valign="middle">
                                    <italic toggle="yes">Blomia tropicalis</italic>
                                </td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">Aquaporin</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">
                                    <ext-link ext-link-type="uri" xlink:href="https://www.uniprot.org/uniprotkb/A0A1Z1W2B1/entry">A0A1Z1W2B1</ext-link>
                                </td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">256</td>
                            </tr>
                            <tr>
                                <td align="left" colspan="1" rowspan="1" valign="middle">
                                    <italic toggle="yes">Euroglyphus maynei</italic>
                                </td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">Aquaporin-like protein</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">
                                    <ext-link ext-link-type="uri" xlink:href="https://www.uniprot.org/uniprotkb/A0A1Y3AUR4/entry">A0A1Y3AUR4</ext-link>
                                </td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">289</td>
                            </tr>
                            <tr>
                                <td align="left" colspan="1" rowspan="1" valign="middle">
                                    <italic toggle="yes">Malus domestica</italic>
                                </td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">Aquaporin</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">
                                    <ext-link ext-link-type="uri" xlink:href="https://www.uniprot.org/uniprotkb/H2EIG5/entry">H2EIG5</ext-link>
                                </td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">144</td>
                            </tr>
                            <tr>
                                <td align="left" colspan="1" rowspan="1" valign="middle">
                                    <italic toggle="yes">Vitis vin&#x00ed;fera</italic>
                                </td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">Aquaporin TIP4-1</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">
                                    <ext-link ext-link-type="uri" xlink:href="https://www.uniprot.org/uniprotkb/A0A438K8X4/entry">A0A438K8X4</ext-link>
                                </td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">196</td>
                            </tr>
                            <tr>
                                <td align="left" colspan="1" rowspan="1" valign="middle">
                                    <italic toggle="yes">Actinidia deliciosa</italic>
                                </td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">Aquaporin PIP2-1</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">
                                    <ext-link ext-link-type="uri" xlink:href="https://www.uniprot.org/uniprotkb/A0A1X9ZIG1/entry">A0A1X9ZIG1</ext-link>
                                </td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">283</td>
                            </tr>
                            <tr>
                                <td align="left" colspan="1" rowspan="1" valign="middle">
                                    <italic toggle="yes">Citrus sinensis</italic>
                                </td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">Putative aquaporin TIP13</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">
                                    <ext-link ext-link-type="uri" xlink:href="https://www.uniprot.org/uniprotkb/A0A067DDA2/entry">A0A067DDA2</ext-link>
                                </td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">251</td>
                            </tr>
                            <tr>
                                <td align="left" colspan="1" rowspan="1" valign="middle">
                                    <italic toggle="yes">Cannabis sativa</italic>
                                </td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">Uncharacterized protein</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">
                                    <ext-link ext-link-type="uri" xlink:href="https://www.uniprot.org/uniprotkb/A0A7J6FF47/entry">A0A7J6FF47</ext-link>
                                </td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">250</td>
                            </tr>
                            <tr>
                                <td align="left" colspan="1" rowspan="1" valign="middle">
                                    <italic toggle="yes">Blatella germanica</italic>
                                </td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">Aquaporin TIP3-1</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">
                                    <ext-link ext-link-type="uri" xlink:href="https://www.uniprot.org/uniprotkb/A0A2P8XIM1/entry">A0A2P8XIM1</ext-link>
                                </td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">200</td>
                            </tr>
                            <tr>
                                <td align="left" colspan="1" rowspan="1" valign="middle">
                                    <italic toggle="yes">Periplaneta americana</italic>
                                </td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">Putative glycerol diffusion channel</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">
                                    <ext-link ext-link-type="uri" xlink:href="https://www.uniprot.org/uniprotkb/D0J8Y8/entry">D0J8Y8</ext-link>
                                </td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">247</td>
                            </tr>
                            <tr>
                                <td align="left" colspan="1" rowspan="1" valign="middle">
                                    <italic toggle="yes">Penaeus vannamei</italic>
                                </td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">Aquaporin</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">
                                    <ext-link ext-link-type="uri" xlink:href="https://www.uniprot.org/uniprotkb/A0A3R7PEU6/entry">A0A3R7PEU6</ext-link>
                                </td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">308</td>
                            </tr>
                            <tr>
                                <td align="left" colspan="1" rowspan="1" valign="middle">
                                    <italic toggle="yes">Canis lupus familiaris</italic>
                                </td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">Aquaporin-3</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">
                                    <ext-link ext-link-type="uri" xlink:href="https://rest.uniprot.org/unisave/E2RI15?format=fasta&amp;versions=70">E2RI15</ext-link>
                                </td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">292</td>
                            </tr>
                            <tr>
                                <td align="left" colspan="1" rowspan="1" valign="middle">
                                    <italic toggle="yes">Felis catus</italic>
                                </td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">Aquaporin-3</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">
                                    <ext-link ext-link-type="uri" xlink:href="https://www.uniprot.org/uniprotkb/A0A2I2UBV1/entry">A0A2I2UBV1</ext-link>
                                </td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">292</td>
                            </tr>
                            <tr>
                                <td align="left" colspan="1" rowspan="1" valign="middle">
                                    <italic toggle="yes">Equus caballus</italic>
                                </td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">Aquaporin-3</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">
                                    <ext-link ext-link-type="uri" xlink:href="https://www.uniprot.org/uniprotkb/F6TFP8/entry">F6TFP8</ext-link>
                                </td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">419</td>
                            </tr>
                            <tr>
                                <td align="left" colspan="1" rowspan="1" valign="middle">
                                    <italic toggle="yes">Bos Taurus</italic>
                                </td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">Aquaporin-3</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">
                                    <ext-link ext-link-type="uri" xlink:href="https://www.uniprot.org/uniprotkb/Q08DE6/entry">Q08DE6</ext-link>
                                </td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">292</td>
                            </tr>
                            <tr>
                                <td align="left" colspan="1" rowspan="1" valign="middle">
                                    <italic toggle="yes">Mus musculus</italic>
                                </td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">Aquaporin-3</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">
                                    <ext-link ext-link-type="uri" xlink:href="https://www.uniprot.org/uniprotkb/Q8R2N1/entry">Q8R2N1</ext-link>
                                </td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">292</td>
                            </tr>
                            <tr>
                                <td align="left" colspan="1" rowspan="1" valign="middle">
                                    <italic toggle="yes">Alternaria alternata</italic>
                                </td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">Aquaporin</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">
                                    <ext-link ext-link-type="uri" xlink:href="https://www.uniprot.org/uniprotkb/A0A177DNX7/entry">A0A177DNX7</ext-link>
                                </td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">408</td>
                            </tr>
                            <tr>
                                <td align="left" colspan="1" rowspan="1" valign="middle">
                                    <italic toggle="yes">Malassezia Sympodialis</italic>
                                </td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">Putative channel-like protein</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">
                                    <ext-link ext-link-type="uri" xlink:href="https://www.uniprot.org/uniprotkb/A0A1M7ZZV8/entry">A0A1M7ZZV8</ext-link>
                                </td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">291</td>
                            </tr>
                            <tr>
                                <td align="left" colspan="1" rowspan="1" valign="middle">
                                    <italic toggle="yes">Saccharomyces cerevisiae</italic>
                                </td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">Aquaglycerol porin AQY3</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">
                                    <ext-link ext-link-type="uri" xlink:href="https://www.uniprot.org/uniprotkb/P43549/entry">P43549</ext-link>
                                </td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">646</td>
                            </tr>
                            <tr>
                                <td align="left" colspan="1" rowspan="1" valign="middle">
                                    <italic toggle="yes">Penicillium chrysogenum</italic>
                                </td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">Aquaporin-3</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">
                                    <ext-link ext-link-type="uri" xlink:href="https://www.uniprot.org/uniprotkb/A0A167PPH9/entry">A0A167PPH9</ext-link>
                                </td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">279</td>
                            </tr>
                            <tr>
                                <td align="left" colspan="1" rowspan="1" valign="middle">
                                    <italic toggle="yes">Penicillium rubens</italic>
                                </td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">Pc12g14590 protein</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">
                                    <ext-link ext-link-type="uri" xlink:href="https://www.uniprot.org/uniprotkb/B6H130/entry">B6H130</ext-link>
                                </td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">306</td>
                            </tr>
                            <tr>
                                <td align="left" colspan="1" rowspan="1" valign="middle">
                                    <italic toggle="yes">Escherichia coli</italic>
                                </td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">Glycerol uptake facilitator protein</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">
                                    <ext-link ext-link-type="uri" xlink:href="https://www.uniprot.org/uniprotkb/P0AER0/entry">P0AER0</ext-link>
                                </td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">281</td>
                            </tr>
                            <tr>
                                <td align="left" colspan="1" rowspan="1" valign="middle">
                                    <italic toggle="yes">Ascaris lumbricoides</italic>
                                </td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">Aquaporin</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">
                                    <ext-link ext-link-type="uri" xlink:href="https://www.uniprot.org/uniprotkb/A0A0M3I310/entry">A0A0M3I310</ext-link>
                                </td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">267</td>
                            </tr>
                            <tr>
                                <td align="left" colspan="1" rowspan="1" valign="middle">
                                    <italic toggle="yes">Staphylococcus aureus</italic>
                                </td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">Glycerol uptake facilitator protein</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">
                                    <ext-link ext-link-type="uri" xlink:href="https://www.ncbi.nlm.nih.gov/protein/AYU99483.1">AYU99483</ext-link>
                                </td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">247</td>
                            </tr>
                        </tbody>
                    </table>
                </table-wrap>
                <table-wrap id="T2" orientation="portrait" position="float">
                    <label>Table 2. </label>
                    <caption>
                        <title>Identity and similarity between AQP3, 
                            <italic toggle="yes">A. fumigatus</italic> aquaporin and aquaporins from allergen sources.</title>
                    </caption>
                    <table content-type="article-table" frame="hsides">
                        <thead>
                            <tr>
                                <th align="left" colspan="1" rowspan="2" valign="top">Sources</th>
                                <th align="left" colspan="3" rowspan="1" valign="top">AQP3</th>
                                <th align="left" colspan="3" rowspan="1" valign="top">
                                    <italic toggle="yes">Aspergillus Fumigatus</italic>
                                </th>
                            </tr>
                            <tr>
                                <th align="left" colspan="1" rowspan="1" valign="top">Identity (%)</th>
                                <th align="left" colspan="1" rowspan="1" valign="top">Similarity (%)</th>
                                <th align="left" colspan="1" rowspan="1" valign="top">Score</th>
                                <th align="left" colspan="1" rowspan="1" valign="top">Identity (%)</th>
                                <th align="left" colspan="1" rowspan="1" valign="top">Similarity (%)</th>
                                <th align="left" colspan="1" rowspan="1" valign="top">Score</th>
                            </tr>
                        </thead>
                        <tbody>
                            <tr>
                                <td align="left" colspan="1" rowspan="1" valign="top">
                                    <italic toggle="yes">Aspergillus fumigatus</italic>
                                </td>
                                <td align="left" colspan="1" rowspan="1" valign="top">32,6</td>
                                <td align="left" colspan="1" rowspan="1" valign="top">47,5</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">492,5</td>
                                <td align="left" colspan="1" rowspan="1" valign="top">-</td>
                                <td align="left" colspan="1" rowspan="1" valign="top">-</td>
                                <td align="left" colspan="1" rowspan="1" valign="top">-</td>
                            </tr>
                            <tr>
                                <td align="left" colspan="1" rowspan="1" valign="top">
                                    <italic toggle="yes">Dermatophagoides pteronyssinus</italic>
                                </td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">18,1</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">32,2</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">42,0</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">15,50</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">25,5</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">41</td>
                            </tr>
                            <tr>
                                <td align="left" colspan="1" rowspan="1" valign="top">
                                    <italic toggle="yes">Dermatophagoides farinae</italic>
                                </td>
                                <td align="left" colspan="1" rowspan="1" valign="top">31,5</td>
                                <td align="left" colspan="1" rowspan="1" valign="top">48,7</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">386,0</td>
                                <td align="left" colspan="1" rowspan="1" valign="top">22,90</td>
                                <td align="left" colspan="1" rowspan="1" valign="top">36</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">291</td>
                            </tr>
                            <tr>
                                <td align="left" colspan="1" rowspan="1" valign="top">
                                    <italic toggle="yes">Blomia tropicalis</italic>
                                </td>
                                <td align="left" colspan="1" rowspan="1" valign="top">19,6</td>
                                <td align="left" colspan="1" rowspan="1" valign="top">32,7</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">44,5</td>
                                <td align="left" colspan="1" rowspan="1" valign="top">13,70</td>
                                <td align="left" colspan="1" rowspan="1" valign="top">20</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">29</td>
                            </tr>
                            <tr>
                                <td align="left" colspan="1" rowspan="1" valign="top">
                                    <italic toggle="yes">Euroglyphus maynei</italic>
                                </td>
                                <td align="left" colspan="1" rowspan="1" valign="top">29</td>
                                <td align="left" colspan="1" rowspan="1" valign="top">46</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">360</td>
                                <td align="left" colspan="1" rowspan="1" valign="top">21,80</td>
                                <td align="left" colspan="1" rowspan="1" valign="top">34,6</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">252,5</td>
                            </tr>
                            <tr>
                                <td align="left" colspan="1" rowspan="1" valign="top">
                                    <italic toggle="yes">Malus domestica</italic>
                                </td>
                                <td align="left" colspan="1" rowspan="1" valign="top">1,7</td>
                                <td align="left" colspan="1" rowspan="1" valign="top">3,2</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">14,5</td>
                                <td align="left" colspan="1" rowspan="1" valign="top">0,20</td>
                                <td align="left" colspan="1" rowspan="1" valign="top">0,9</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">3</td>
                            </tr>
                            <tr>
                                <td align="left" colspan="1" rowspan="1" valign="top">
                                    <italic toggle="yes">Vitis vinifera</italic>
                                </td>
                                <td align="left" colspan="1" rowspan="1" valign="top">1,7</td>
                                <td align="left" colspan="1" rowspan="1" valign="top">30,5</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">175</td>
                                <td align="left" colspan="1" rowspan="1" valign="top">18,20</td>
                                <td align="left" colspan="1" rowspan="1" valign="top">27,7</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">149,5</td>
                            </tr>
                            <tr>
                                <td align="left" colspan="1" rowspan="1" valign="top">
                                    <italic toggle="yes">Actinidia deliciosa</italic>
                                </td>
                                <td align="left" colspan="1" rowspan="1" valign="top">21,2</td>
                                <td align="left" colspan="1" rowspan="1" valign="top">32,9</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">218,5</td>
                                <td align="left" colspan="1" rowspan="1" valign="top">24,30</td>
                                <td align="left" colspan="1" rowspan="1" valign="top">38</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">247</td>
                            </tr>
                            <tr>
                                <td align="left" colspan="1" rowspan="1" valign="top">
                                    <italic toggle="yes">Citrus sinensis</italic>
                                </td>
                                <td align="left" colspan="1" rowspan="1" valign="top">25,4</td>
                                <td align="left" colspan="1" rowspan="1" valign="top">38,4</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">193,5</td>
                                <td align="left" colspan="1" rowspan="1" valign="top">18,80</td>
                                <td align="left" colspan="1" rowspan="1" valign="top">29,6</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">167</td>
                            </tr>
                            <tr>
                                <td align="left" colspan="1" rowspan="1" valign="top">
                                    <italic toggle="yes">Cannabis sativa</italic>
                                </td>
                                <td align="left" colspan="1" rowspan="1" valign="top">24,6</td>
                                <td align="left" colspan="1" rowspan="1" valign="top">39</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">190,5</td>
                                <td align="left" colspan="1" rowspan="1" valign="top">19,50</td>
                                <td align="left" colspan="1" rowspan="1" valign="top">34,7</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">167</td>
                            </tr>
                            <tr>
                                <td align="left" colspan="1" rowspan="1" valign="top">
                                    <italic toggle="yes">Blatella germanica</italic>
                                </td>
                                <td align="left" colspan="1" rowspan="1" valign="top">22,6</td>
                                <td align="left" colspan="1" rowspan="1" valign="top">33,4</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">141,0</td>
                                <td align="left" colspan="1" rowspan="1" valign="top">15,90</td>
                                <td align="left" colspan="1" rowspan="1" valign="top">23,2</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">84,5</td>
                            </tr>
                            <tr>
                                <td align="left" colspan="1" rowspan="1" valign="top">
                                    <italic toggle="yes">Periplaneta americana</italic>
                                </td>
                                <td align="left" colspan="1" rowspan="1" valign="top">27,1</td>
                                <td align="left" colspan="1" rowspan="1" valign="top">44,4</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">332</td>
                                <td align="left" colspan="1" rowspan="1" valign="top">24,20</td>
                                <td align="left" colspan="1" rowspan="1" valign="top">34</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">330</td>
                            </tr>
                            <tr>
                                <td align="left" colspan="1" rowspan="1" valign="top">
                                    <italic toggle="yes">Penaeus vannamei</italic>
                                </td>
                                <td align="left" colspan="1" rowspan="1" valign="top">14,9</td>
                                <td align="left" colspan="1" rowspan="1" valign="top">28,5</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">80,5</td>
                                <td align="left" colspan="1" rowspan="1" valign="top">13,00</td>
                                <td align="left" colspan="1" rowspan="1" valign="top">20,2</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">27</td>
                            </tr>
                            <tr>
                                <td align="left" colspan="1" rowspan="1" valign="top">
                                    <italic toggle="yes">Canis lupus familiaris</italic>
                                </td>
                                <td align="left" colspan="1" rowspan="1" valign="top">72,9</td>
                                <td align="left" colspan="1" rowspan="1" valign="top">75,9</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">1294</td>
                                <td align="left" colspan="1" rowspan="1" valign="top">33,90</td>
                                <td align="left" colspan="1" rowspan="1" valign="top">50,3</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">468,5</td>
                            </tr>
                            <tr>
                                <td align="left" colspan="1" rowspan="1" valign="top">
                                    <italic toggle="yes">Felis catus</italic>
                                </td>
                                <td align="left" colspan="1" rowspan="1" valign="top">95,5</td>
                                <td align="left" colspan="1" rowspan="1" valign="top">97,6</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">1484</td>
                                <td align="left" colspan="1" rowspan="1" valign="top">33,10</td>
                                <td align="left" colspan="1" rowspan="1" valign="top">48,4</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">508,5</td>
                            </tr>
                            <tr>
                                <td align="left" colspan="1" rowspan="1" valign="top">
                                    <italic toggle="yes">Equus caballus</italic>
                                </td>
                                <td align="left" colspan="1" rowspan="1" valign="top">66,6</td>
                                <td align="left" colspan="1" rowspan="1" valign="top">68,7</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">1497</td>
                                <td align="left" colspan="1" rowspan="1" valign="top">27,90</td>
                                <td align="left" colspan="1" rowspan="1" valign="top">42,7</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">498</td>
                            </tr>
                            <tr>
                                <td align="left" colspan="1" rowspan="1" valign="top">
                                    <italic toggle="yes">Bos taurus</italic>
                                </td>
                                <td align="left" colspan="1" rowspan="1" valign="top">94,9</td>
                                <td align="left" colspan="1" rowspan="1" valign="top">98,3</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">1486</td>
                                <td align="left" colspan="1" rowspan="1" valign="top">32,80</td>
                                <td align="left" colspan="1" rowspan="1" valign="top">48,1</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">497,5</td>
                            </tr>
                            <tr>
                                <td align="left" colspan="1" rowspan="1" valign="top">
                                    <italic toggle="yes">Mus musculus</italic>
                                </td>
                                <td align="left" colspan="1" rowspan="1" valign="top">95,5</td>
                                <td align="left" colspan="1" rowspan="1" valign="top">98,6</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">1493</td>
                                <td align="left" colspan="1" rowspan="1" valign="top">33,10</td>
                                <td align="left" colspan="1" rowspan="1" valign="top">48,1</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">506,5</td>
                            </tr>
                            <tr>
                                <td align="left" colspan="1" rowspan="1" valign="top">
                                    <italic toggle="yes">Alternaria alternata</italic>
                                </td>
                                <td align="left" colspan="1" rowspan="1" valign="top">15,6</td>
                                <td align="left" colspan="1" rowspan="1" valign="top">25,4</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">214</td>
                                <td align="left" colspan="1" rowspan="1" valign="top">14,50</td>
                                <td align="left" colspan="1" rowspan="1" valign="top">22,6</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">205</td>
                            </tr>
                            <tr>
                                <td align="left" colspan="1" rowspan="1" valign="top">
                                    <italic toggle="yes">Malassezia Simpodiales</italic>
                                </td>
                                <td align="left" colspan="1" rowspan="1" valign="top">33,1</td>
                                <td align="left" colspan="1" rowspan="1" valign="top">49,5</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">401,5</td>
                                <td align="left" colspan="1" rowspan="1" valign="top">35,90</td>
                                <td align="left" colspan="1" rowspan="1" valign="top">49,6</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">516</td>
                            </tr>
                            <tr>
                                <td align="left" colspan="1" rowspan="1" valign="top">
                                    <italic toggle="yes">Saccharomyces cerevisiae</italic>
                                </td>
                                <td align="left" colspan="1" rowspan="1" valign="top">15,8</td>
                                <td align="left" colspan="1" rowspan="1" valign="top">25,1</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">516</td>
                                <td align="left" colspan="1" rowspan="1" valign="top">22,60</td>
                                <td align="left" colspan="1" rowspan="1" valign="top">31,4</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">668,5</td>
                            </tr>
                            <tr>
                                <td align="left" colspan="1" rowspan="1" valign="top">
                                    <italic toggle="yes">Penicillium chrysogenum</italic>
                                </td>
                                <td align="left" colspan="1" rowspan="1" valign="top">33,2</td>
                                <td align="left" colspan="1" rowspan="1" valign="top">50,9</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">377,5</td>
                                <td align="left" colspan="1" rowspan="1" valign="top">3,50</td>
                                <td align="left" colspan="1" rowspan="1" valign="top">43,4</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">477</td>
                            </tr>
                            <tr>
                                <td align="left" colspan="1" rowspan="1" valign="top">
                                    <italic toggle="yes">Penicillium rubens</italic>
                                </td>
                                <td align="left" colspan="1" rowspan="1" valign="top">24,6</td>
                                <td align="left" colspan="1" rowspan="1" valign="top">35,2</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">205</td>
                                <td align="left" colspan="1" rowspan="1" valign="top">20,90</td>
                                <td align="left" colspan="1" rowspan="1" valign="top">32,8</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">144,5</td>
                            </tr>
                            <tr>
                                <td align="left" colspan="1" rowspan="1" valign="top">
                                    <italic toggle="yes">Escherichia coli</italic>
                                </td>
                                <td align="left" colspan="1" rowspan="1" valign="top">35,6</td>
                                <td align="left" colspan="1" rowspan="1" valign="top">53,2</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">475,5</td>
                                <td align="left" colspan="1" rowspan="1" valign="top">31,70</td>
                                <td align="left" colspan="1" rowspan="1" valign="top">45,2</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">436,5</td>
                            </tr>
                            <tr>
                                <td align="left" colspan="1" rowspan="1" valign="top">
                                    <italic toggle="yes">Ascaris lumbricoides</italic>
                                </td>
                                <td align="left" colspan="1" rowspan="1" valign="top">9,9</td>
                                <td align="left" colspan="1" rowspan="1" valign="top">16,1</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">30,5</td>
                                <td align="left" colspan="1" rowspan="1" valign="top">10,40</td>
                                <td align="left" colspan="1" rowspan="1" valign="top">16,7</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">17,5</td>
                            </tr>
                            <tr>
                                <td align="left" colspan="1" rowspan="1" valign="top">
                                    <italic toggle="yes">Staphylococcus aureus</italic>
                                </td>
                                <td align="left" colspan="1" rowspan="1" valign="top">31,7</td>
                                <td align="left" colspan="1" rowspan="1" valign="top">43,6</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">377,5</td>
                                <td align="left" colspan="1" rowspan="1" valign="top">27,70</td>
                                <td align="left" colspan="1" rowspan="1" valign="top">37,4</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">337,5</td>
                            </tr>
                        </tbody>
                    </table>
                </table-wrap>
            </sec>
            <sec id="sec13">
                <title>Phylogenetic analysis</title>
                <p>Phylogenetic relationships were determined using the neighbor-joining method, incorporating all 27 amino acid sequences. The resulting phylogenetic tree is presented in a circular format in 
                    <xref ref-type="fig" rid="f1">Figure 1</xref>. Evolutionary distances were calculated using the Poisson correction method and were exprex|ssed as the number of amino acid substitutions per site. The tree visually represents the grouping and arrangement of the analyzed aquaporins, facilitating a comprehensive comparison and revealing their interrelatedness.</p>
                <fig fig-type="figure" id="f1" orientation="portrait" position="float">
                    <label>Figure 1. </label>
                    <caption>
                        <title>Phylogenetic tree based on amino acid sequences of the studied aquaporins.</title>
                        <p>The sums of branch lengths for an optimal tree totaled 12.5. The tree reveals the formation of five groups, designated as letters from A to E.</p>
                    </caption>
                    <graphic id="gr1" orientation="portrait" position="float" xlink:href="https://f1000research-files.f1000.com/manuscripts/156440/d9f91eac-dba1-4559-921d-dd7f6e77a6a6_figure1.gif"/>
                </fig>
                <p>Based on branch distances, the phylogenetic tree presented the formation of five distinct groups, denoted as letters A to E. Multiple sequence alignments were performed using the Praline server to further explore the similarities within each group. Group A consisted of fungal species with a shared identity of 39%, whereas group B comprised mammalian aquaporins with a high identity of 95%. Group C was composed of two mite species with an identity of 53%, group D encompassed plant sources with 40% identity, and group E included pathogens and mites with an identity of 31%. Notably, this analysis revealed significant allergen sources in tropical regions, such as 
                    <italic toggle="yes">D. pteronissinus</italic> and 
                    <italic toggle="yes">B. tropicalis.</italic>
                </p>
                <p>Species such as 
                    <italic toggle="yes">P. americana, S. aureus, E. coli, B. germanica,</italic> and 
                    <italic toggle="yes">M. domestica</italic> did not fit within any specific group because of their substantial branch distances from the root of clustering. Consequently, they were categorized into independent groups. Among the identified groups, those most closely related to the aquaporins of 
                    <italic toggle="yes">A. fumigatus</italic> and humans were found in groups A and B. Additionally, noteworthy proximity was observed between 
                    <italic toggle="yes">E. coli</italic> and 
                    <italic toggle="yes">D. farinae</italic> in group B.</p>
                <p>The guidance provided by the phylogenetic tree and the results of paired alignments of the EMBOSS needle and aquaporin sequences were selected with a score &#x2265;380. This threshold ensured an identity greater than 30% for each aquaporin sequence. Subsequently, paired alignments of the selected aquaporins against 
                    <italic toggle="yes">A. fumigatus</italic> were performed using Praline. This approach provides a more visually informative result, enabling a better understanding of the conserved regions in each sequence (
                    <xref ref-type="fig" rid="f2">Figure 2</xref>). By employing this screening process, we can identify more conserved sequences, thus increasing the likelihood of identifying regions that may contain potential epitopes.</p>
                <fig fig-type="figure" id="f2" orientation="portrait" position="float">
                    <label>Figure 2. </label>
                    <caption>
                        <title>Sequence alignment of aquaporins from 
                            <italic toggle="yes">A. fumigatus</italic> and humans was performed using Praline.</title>
                        <p>The colors used in the alignment represent the level of sequence conservation, with blue indicating lower conservation and red indicating higher conservation. In the accompanying image, highlighted boxes denote the most conserved regions in the sequence, with each color (red, yellow, and green) representing the degree of conservation in descending order.</p>
                    </caption>
                    <graphic id="gr2" orientation="portrait" position="float" xlink:href="https://f1000research-files.f1000.com/manuscripts/156440/d9f91eac-dba1-4559-921d-dd7f6e77a6a6_figure2.gif"/>
                </fig>
            </sec>
            <sec id="sec14">
                <title>Aquaporin 3D models</title>
                <p>Using PyMOL, we visualized the structures of the 12 selected aquaporin proteins. They were represented in the form of &#x201c;cartoons&#x201d; and were color-coded using the spectrum. These models exhibit the characteristic structure of aquaporins, consisting of six alpha helices connected by extracellular and intracellular &#x201c;loops&#x201d; that form the water and substance transport channel (
                    <xref ref-type="fig" rid="f3">Figure 3</xref>).</p>
                <fig fig-type="figure" id="f3" orientation="portrait" position="float">
                    <label>Figure 3. </label>
                    <caption>
                        <title>Structures of aquaporins obtained from sources including PDB, Uniprot, AlphaFold, and Swiss-model. Their clustering corresponds to the arrangement in the phylogenetic tree. (A) This cluster comprises aquaporins from fungi. (B) Aquaporins from animals, except for 
                            <italic toggle="yes">E. coli</italic>, belong to this group.</title>
                    </caption>
                    <graphic id="gr3" orientation="portrait" position="float" xlink:href="https://f1000research-files.f1000.com/manuscripts/156440/d9f91eac-dba1-4559-921d-dd7f6e77a6a6_figure3.gif"/>
                </fig>
                <p>Moreover, certain structures display distinctive extensions in their amino acid chains, resulting in variations in their tertiary structures. Examples include 
                    <italic toggle="yes">S. cerevisiae</italic> and 
                    <italic toggle="yes">E. caballus.</italic> Consequently, during epitope exploration, most of these regions were exposed, leading to the exclusion of these sequences as potential allergenic sources due to the absence of epitopes in the conserved regions of interest. This minimized the likelihood of cross-reactivity.</p>
            </sec>
            <sec id="sec15">
                <title>Prediction of linear and discontinuous epitopes</title>
                <p>Using the 3D structures of 
                    <italic toggle="yes">A. fumigatus</italic>, 
                    <italic toggle="yes">Homo sapiens, Dermatophagoides farinae, Canis lupus familiaris, Felis catus, Equus caballus, Bos taurus, Mus musculus, Malassezia Sympodialis, Saccharomyces cerevisiae, Penicillium chrysogenum, and Escherichia coli</italic>, we predicted the linear and discontinuous epitopes for each aquaporin (
                    <xref ref-type="table" rid="T3">Table 3</xref>). We utilized PyMOL to analyze the identified linear and conformational epitopes, and thoroughly examined the distinct regions within each of these 3D structures. These epitopes are marked with the representative colors in the 3D structure. Although this characterization was performed for all 12 studied aquaporins, this work focused only on the epitopes found in the aquaporins of interest (
                    <italic toggle="yes">A. fumigatus</italic> and AQP3), as shown in 
                    <xref ref-type="fig" rid="f4">Figures 4</xref> and 
                    <xref ref-type="fig" rid="f5">5</xref>.</p>
                <table-wrap id="T3" orientation="portrait" position="float">
                    <label>Table 3. </label>
                    <caption>
                        <title>Lineal and discontinuous epitotpes from 
                            <italic toggle="yes">A. fumigatus</italic> and human aquaporin 3 (AQP3).</title>
                    </caption>
                    <table content-type="article-table" frame="hsides">
                        <thead>
                            <tr>
                                <th align="left" colspan="7" rowspan="1" valign="top">
                                    <italic toggle="yes">Aspergillus Fumigatus</italic> aquaporin</th>
                            </tr>
                            <tr>
                                <th align="left" colspan="7" rowspan="1" valign="top">Lineal Epitopes</th>
                            </tr>
                            <tr>
                                <th align="left" colspan="1" rowspan="1" valign="top">No.</th>
                                <th align="left" colspan="1" rowspan="1" valign="top">Chain</th>
                                <th align="left" colspan="1" rowspan="1" valign="top">Start</th>
                                <th align="left" colspan="1" rowspan="1" valign="top">Final</th>
                                <th align="left" colspan="1" rowspan="1" valign="top">Peptide</th>
                                <th align="left" colspan="1" rowspan="1" valign="top">N. Residues</th>
                                <th align="left" colspan="1" rowspan="1" valign="top">Score</th>
                            </tr>
                        </thead>
                        <tbody>
                            <tr>
                                <td align="left" colspan="1" rowspan="1" valign="middle">1</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">A</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">218</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">231</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">DDGNIGAGPLTPLA</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">14</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">0,763</td>
                            </tr>
                            <tr>
                                <td align="left" colspan="1" rowspan="1" valign="middle">2</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">A</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">80</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">93</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">QVTLSKGEKGDYQS</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">13</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">0,7</td>
                            </tr>
                            <tr>
                                <td align="left" colspan="1" rowspan="1" valign="middle">3</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">A</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">151</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">180</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">AIVYGNYRSAIDQFEGGAHIRTVPGYSPTA</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">30</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">0,7</td>
                            </tr>
                            <tr>
                                <td align="left" colspan="7" rowspan="1" valign="middle">
                                    <bold>Discontinuous Epitopes</bold>
                                </td>
                            </tr>
                            <tr>
                                <td align="left" colspan="1" rowspan="1" valign="middle">1</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">A</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">54</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">61</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">A:R54, A:T55, A:Y56, A:C57, A:R58, A:D59, A:A60, A:F61</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">8</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">0,869</td>
                            </tr>
                            <tr>
                                <td align="left" colspan="1" rowspan="1" valign="middle">2</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">A</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">211</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">306</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">A:F211, A:F293, A:G295, A:W296, A:I297, A:Y298, A:D299, A:M300, A:F301, A:L302, A:Y303, A:T304, A:G305, A:T306</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">14</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">0,815</td>
                            </tr>
                            <tr>
                                <td align="left" colspan="1" rowspan="1" valign="middle">3</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">A</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">215</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">234</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">A:A215, A:D218, A:D219, A:G220, A:N221, A:I222, A:G223, A:A224, A:G225, A:P226, A:L227, A:T228, A:L230, A:A231, A:F234</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">15</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">0,763</td>
                            </tr>
                            <tr>
                                <td align="left" colspan="7" rowspan="1" valign="middle">
                                    <bold>Human Aquaporin 3</bold>
                                </td>
                            </tr>
                            <tr>
                                <td align="left" colspan="7" rowspan="1" valign="top">
                                    <bold>Lineal Epitopes</bold>
                                </td>
                            </tr>
                            <tr>
                                <td align="left" colspan="1" rowspan="1" valign="middle">1</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">A</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">1</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">23</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">MGRQKELVSRCGEMLHIRYRLLR</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">23</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">0,872</td>
                            </tr>
                            <tr>
                                <td align="left" colspan="1" rowspan="1" valign="middle">2</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">A</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">259</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">292</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">FVYQLMIGCHLEQPPPSNEEENVKLAHVKHKEQI</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">34</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">0,856</td>
                            </tr>
                            <tr>
                                <td align="left" colspan="1" rowspan="1" valign="middle">3</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">A</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">45</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">58</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">QVVLSRGTHGGFLT</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">14</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">0,709</td>
                            </tr>
                            <tr>
                                <td align="left" colspan="1" rowspan="1" valign="middle">4</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">A</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">120</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">143</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">FGLYYDAIWHFADNQLFVSGPNGT</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">24</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">0,702</td>
                            </tr>
                            <tr>
                                <td align="left" colspan="5" rowspan="1" valign="top">
                                    <bold>Discontinuous Epitopes</bold>
                                </td>
                                <td colspan="1" rowspan="1"/>
                                <td colspan="1" rowspan="1"/>
                            </tr>
                            <tr>
                                <td align="left" colspan="1" rowspan="1" valign="middle">1</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">A</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">1</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">5</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">A:M1, A:G2, A:R3, A:Q4, A:K5</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">5</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">0,957</td>
                            </tr>
                            <tr>
                                <td align="left" colspan="1" rowspan="1" valign="middle">2</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">A</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">271</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">285</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">A:Q271, A:P272, A:P273, A:P274, A:S275, A:N276, A:E278, A:E279, A:N280, A:V281, A:K282, A:L283, A:A284, A:H285</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">14</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">0,914</td>
                            </tr>
                            <tr>
                                <td align="left" colspan="1" rowspan="1" valign="middle">3</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">A</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">6</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">103</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">A:E6, A:L7, A:V8, A:S9, A:R10, A:C11, A:G12, A:E13, A:M14, A:L15, A:H16, A:I17, A:L21, A:L22, A:R23, A:L26, A:E96, A:P97, A:I99, A:P102, A:I103</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">21</td>
                                <td align="left" colspan="1" rowspan="1" valign="middle">0,775</td>
                            </tr>
                        </tbody>
                    </table>
                </table-wrap>
                <fig fig-type="figure" id="f4" orientation="portrait" position="float">
                    <label>Figure 4. </label>
                    <caption>
                        <title>Depiction of predicted linear epitopes.</title>
                        <p>All epitopes are color-coded on the surface models. Red, green, blue, and yellow correspond to the highest values, respectively.</p>
                    </caption>
                    <graphic id="gr4" orientation="portrait" position="float" xlink:href="https://f1000research-files.f1000.com/manuscripts/156440/d9f91eac-dba1-4559-921d-dd7f6e77a6a6_figure4.gif"/>
                </fig>
                <fig fig-type="figure" id="f5" orientation="portrait" position="float">
                    <label>Figure 5. </label>
                    <caption>
                        <title>Representation of predicted discontinuous epitopes from 
                            <italic toggle="yes">A. fumigatus</italic> aquaporin and AQP3. All epitopes are highlighted with color on the surface models, where red, green, and blue signify the highest values, respectively.</title>
                    </caption>
                    <graphic id="gr5" orientation="portrait" position="float" xlink:href="https://f1000research-files.f1000.com/manuscripts/156440/d9f91eac-dba1-4559-921d-dd7f6e77a6a6_figure5.gif"/>
                </fig>
                <p>Furthermore, the PyMOL visualization program allowed us to calculate the root mean standard deviation (RMSD), which measures the structural similarity between two aligned objects, specifically the proteins of interest (
                    <xref ref-type="fig" rid="f6">Figure 6</xref>). The closer the RMSD value is to zero, the stronger the molecular similarity between the proteins. We obtained an RMSD value of 1.003, indicating a significant molecular similarity.</p>
                <fig fig-type="figure" id="f6" orientation="portrait" position="float">
                    <label>Figure 6. </label>
                    <caption>
                        <title>The structural overlap of 
                            <italic toggle="yes">A. fumigatus</italic> aquaporin (magenta) and human aquaporin AQP3 (cyan) is depicted in a cartoon model. The root-mean-square deviation (RMSD) is 1.003.</title>
                    </caption>
                    <graphic id="gr6" orientation="portrait" position="float" xlink:href="https://f1000research-files.f1000.com/manuscripts/156440/d9f91eac-dba1-4559-921d-dd7f6e77a6a6_figure6.gif"/>
                </fig>
                <p>In addition, we identified epitopes that contained conserved sequences. In the case of fungal aquaporins, Linear Epitope (LE) 2 was identified, whereas in human aquaporins, LE 3 was found. Individual analysis revealed highly conserved fragments with more than four residues. For fungal aquaporins, the conserved residue is 80QVTLSKG86, whereas for human aquaporins, it is 45QVVLSRG52. The percentage of identity and similarity between these fragments was 71.4% and 85.7%, respectively, suggesting that these residues were highly likely to be antigenic patches (
                    <xref ref-type="fig" rid="f7">Figures 7</xref> and 
                    <xref ref-type="fig" rid="f8">8</xref>).</p>
                <fig fig-type="figure" id="f7" orientation="portrait" position="float">
                    <label>Figure 7. </label>
                    <caption>
                        <title>Potential similar antigenic patches in linear epitopes of 
                            <italic toggle="yes">A. fumigatus</italic> aquaporin and AQP3.</title>
                    </caption>
                    <graphic id="gr7" orientation="portrait" position="float" xlink:href="https://f1000research-files.f1000.com/manuscripts/156440/d9f91eac-dba1-4559-921d-dd7f6e77a6a6_figure7.gif"/>
                </fig>
                <fig fig-type="figure" id="f8" orientation="portrait" position="float">
                    <label>Figure 8. </label>
                    <caption>
                        <title>Identification of transmembrane functional activity domains in the aquaporin proteins of human AQP3 and the fungus 
                            <italic toggle="yes">A. fumigatus</italic> through color-coded assignment in their secondary structure.</title>
                    </caption>
                    <graphic id="gr8" orientation="portrait" position="float" xlink:href="https://f1000research-files.f1000.com/manuscripts/156440/d9f91eac-dba1-4559-921d-dd7f6e77a6a6_figure8.gif"/>
                </fig>
            </sec>
        </sec>
        <sec id="sec16" sec-type="discussion">
            <title>Discussion</title>
            <p>Numerous diseases, including atopic dermatitis, bullous pemphigoid, chronic spontaneous urticaria, and multiple sclerosis, are associated with the presence of IgE autoantibodies. In the context of allergic responses intertwined with autoimmunity, researchers have categorized autoantigens that bind to IgE into three functional groups: 1) autoantigens that share sequence homology with environmental allergens, 2) autoantigens that lack sequence homology with known environmental allergens, and 3) chemically modified autoantigens. However, the identification of environmental allergens with homology to human proteins and their influence on the allergic response vary among these autoantigens, and their clinical significance often remains unclear.
                <sup>
                    <xref ref-type="bibr" rid="ref19">19</xref>
                </sup>
            </p>
            <p>Aquaporin is a promising protein candidate for studying cutaneous, autoimmune, and allergic diseases, including atopic dermatitis (AD), because of its involvement in epidermal hydration and transportation of various substances such as glycerol, salts, and exocrine fluids. These functions contribute to skin dryness, which, in turn, facilitates the filtration of allergens.
                <sup>
                    <xref ref-type="bibr" rid="ref14">14</xref>
                </sup> This protein is widely present in numerous organisms, and exhibits a diverse range of isoforms and functions across different taxonomic groups.</p>
            <p>Recent research has identified the presence of aquaporins in allergenic species such as dust mites.
                <sup>
                    <xref ref-type="bibr" rid="ref20">20</xref>
                </sup> Mao et al. characterized the proteome of 
                <italic toggle="yes">Dermatophagoides farinae</italic>, and two-dimensional immunoblotting revealed the binding of IgE antibodies to a band with the same isoelectric point and molecular weight as the aquaporin family, suggesting its potential role as an allergen.
                <sup>
                    <xref ref-type="bibr" rid="ref21">21</xref>
                </sup>
            </p>
            <p>On the other hand, in a systematic review, a total of 32 articles were examined to assess the role of the microbiota in atopic dermatitis. The microbiome profile revealed substantial variation in bacterial diversity along with an increased presence of fungi. Notably, there was diversification and expansion of species belonging to the genus 
                <italic toggle="yes">Aspergillus</italic> within the fungal group, whereas a reduction in the number of 
                <italic toggle="yes">Malassezia</italic> spp. was observed. Research has also demonstrated that 
                <italic toggle="yes">A. fumigatus</italic> is a prominent source of sensitization in patients with severe atopic dermatitis. Additionally, the presence of new allergens from this species is believed to have a significant impact on the severity of the condition.
                <sup>
                    <xref ref-type="bibr" rid="ref22">22</xref>
                </sup>
            </p>
            <p>The comprehensive analysis of aquaporins provides guidance for considering other potential allergenic sources beyond the main aquaporins studied, namely AQP3 and 
                <italic toggle="yes">A. fumigatus</italic> aquaporin. We conducted a comparative analysis of 25 aquaporin sequences from various sources, including 
                <italic toggle="yes">A. fumigatus</italic> aquaporin and human aquaporin 3 (AQP3). A comparison between 
                <italic toggle="yes">A. fumigatus</italic> aquaporin and AQP3 revealed an identity of 32.6% and similarity of 47.5%, indicating a relevant level of homology between these two proteins despite the evolutionary gap and taxonomic diversification among species. Notably, human AQP3 exhibited the maximum identity and similarity values of 95.5% and 98.6%, respectively. These high values could be attributed to the inclusion of aquaporins from mammalian allergen sources. Given that these species belong to a taxonomic group closer to humans, it is understandable that the APQs are more conserved.</p>
            <p>Five clades were constructed for the phylogenetic analysis. A and B showed the highest identity with 
                <italic toggle="yes">A. fumigatus</italic> aquaporins and AQP3. The alignment results suggest that divergence among aquaporins primarily occurs in smaller species, while it remains conserved in mammals. In addition, the presence of aquaporin isoforms, each with special functions and locations, such as AQP3, indicates functional and phenotypic variability among different cell types within the same organism. However, despite this diversity, the identity of aquaporins within the clades revealed values higher than 30%, particularly in clade B (95%), indicating that if the protein is recognized by antibodies, potential cross-reactivity among these species can occur.</p>
            <p>Only a limited number of studies have investigated the relationship between aquaporins derived from allergenic sources and their potential relevance in human diseases. Zhou 
                <italic toggle="yes">et al.</italic> conducted an assessment using transcriptomics to identify potential AQPs in 
                <italic toggle="yes">Blomia tropicalis</italic> using molecular cloning techniques, followed by a comparative analysis of identity among mite aquaporin sequences and human aquaporins. The author identified five putative AQP-coding sequences, known as BlotAQP1-5, which were indexed into all three subgroups: AQPs, aquaglyceroporins, and superAQPs. BlotAQP1, BlotAQP2, and BlotAQP5 were clustered with the aquaglyceroporins hAQP3, hAQP7, hAQP9, and hAQP10, with a common sequence consensus &#x2018;N-G-NPSRD-PRL.&#x2019; The molecular weight and isoelectric point of these molecules were consistent with the findings reported by Mao 
                <italic toggle="yes">et al.</italic> in their two-dimensional electrophoresis study.
                <sup>
                    <xref ref-type="bibr" rid="ref23">23</xref>
                </sup> This observation suggests the potential recognition of aquaporins, specifically aquaglycerins such as AQP3, by IgE in patients with allergies. These results are consistent with those presented in our findings, where despite the evolutionary distance between species, there is an identity exceeding 30% and consensus sequences that may serve as potential antigenic patches.</p>
            <p>In contrast, in regions where higher conservation was observed among the sequences, neither linear nor conformational epitopes were identified. This is attributed to the fact that these sequences are in the transmembrane region of the protein, which limits their accessibility to antibodies. However, despite the absence of epitopes, these conserved regions are interesting. During cell lysis caused by mechanical injury or microbial effects, these proteins can be linearly exposed, leading to the emergence of neoepitopes that can be recognized by IgE or phagocytic cells.
                <sup>
                    <xref ref-type="bibr" rid="ref24">24</xref>
                </sup>
            </p>
            <p>Although little is known about the role of AQP3 as an allergen or autoantigen, other aquaporins have been studied for their relevance as antigens in autoimmune diseases. Sagan 
                <italic toggle="yes">et al.</italic> investigated the relevance of AQP4 as an autoantigen in neuromyelitis optica, recognized by T lymphocytes, in an animal model.
                <sup>
                    <xref ref-type="bibr" rid="ref25">25</xref>
                </sup> This aquaporin is a water channel expressed in astrocytes in areas in contact with the blood-brain barrier, and 75% of patients with neuromyelitis have antibodies capable of recognizing AQP4. Therefore, the relevance of human aquaporins found in other tissues, such as AQP3 in the skin, can be considered as potential autoantigens and, through molecular mimicry, triggers relevant skin diseases such as atopic dermatitis.
                <sup>
                    <xref ref-type="bibr" rid="ref26">26</xref>
                </sup> Evidence indicates cross-reactivity with aquaporins expressed by bacteria and mycobacteria, including 
                <italic toggle="yes">Escherichia coli</italic> and Mycobacterium species, in relation to this specific autoantigen.
                <sup>
                    <xref ref-type="bibr" rid="ref27">27</xref>
                </sup> This indicated that antibodies targeting aquaporins from 
                <italic toggle="yes">A. fumigatus</italic> could potentially recognize and target this autoantigen. In a previous study, we found that AQP4 exhibits only one predicted cross-reactive epitope. It has been postulated that the recognition of a single epitope by autoantibodies could trigger an epitope spreading mechanism, leading to the involvement of additional autoantigens in the immune response.
                <sup>
                    <xref ref-type="bibr" rid="ref28">28</xref>
                </sup> For both 
                <italic toggle="yes">A. fumigatus</italic> aquaporins and AQP3, a total of four linear epitopes and three discontinuous epitopes were described. Structural superimposition highlighted a notable degree of similarity between the proteins, indicating that the epitopes could reside within the corresponding antigenic regions. This observation supports the idea of a potential molecular mimicry between these proteins.</p>
            <p>It is important to acknowledge that our study has several limitations. In silico modeling and epitope prediction analyses are not definitive, and there may be variations in the actual structure compared with our proposed models. Nonetheless, bioinformatic analyses offer several advantages in directing research resources efficiently. They play a crucial role in the preliminary assessment of hypotheses and help to determine whether it is justified to proceed with in vitro or ex vivo experiments.</p>
        </sec>
        <sec id="sec17" sec-type="conclusion">
            <title>Conclusion</title>
            <p>During alignment of aquaporin sequences from A. fumigatus and AQP3, specific conserved epitopes were observed. Analysis revealed that the local sequence identity exceeded 70%, indicating molecular mimicry in these regions of both aquaporins. Further investigation of epitopes and domain identification revealed the most conserved region in transmembrane domains 12 and 14 of the respective aquaporins. This study represents a groundbreaking contribution to the exploration and analysis of aquaporin as a potential allergen and autoallergen in atopic dermatitis, as it is the first known study to focus on this subject. To confirm cross-reactivity, future in vitro studies are needed to demonstrate the IgE-binding capacity in these regions.</p>
            <p>By acquiring knowledge regarding the sequences and structures of potential epitopes from different allergenic sources, we can modify and synthesize these molecules for future in vitro and in vivo studies. This not only expands the literature in the field of immunotherapy but also facilitates the diagnosis and treatment of autoimmune diseases such as atopic dermatitis. It is important to note that in silico tests optimize these studies by providing rapid results and circumventing the high costs associated with laboratory testing.</p>
        </sec>
    </body>
    <back>
        <sec id="sec20" sec-type="data-availability">
            <title>Data availability</title>
            <p>Allermatch (
                <ext-link ext-link-type="uri" xlink:href="https://allermatch.org/">https://allermatch.org/</ext-link>)</p>
            <p>UniProt (
                <ext-link ext-link-type="uri" xlink:href="https://www.uniprot.org/">https://www.uniprot.org/</ext-link>)</p>
            <p>National Center for Biotechnology Information (NCBI) databases (
                <ext-link ext-link-type="uri" xlink:href="https://www.ncbi.nlm.nih.gov/">https://www.ncbi.nlm.nih.gov/</ext-link>).</p>
            <p>There is no further data associated with this article.</p>
        </sec>
        <ack>
            <title>Acknowledgements</title>
            <p>We thank the participants coauthor and institutions for their support in collecting the information. A preprint version of this article can be found (
                <ext-link ext-link-type="uri" xlink:href="https://www.techrxiv.org/doi/full/10.22541/au.169521327.76672515">https://www.techrxiv.org/doi/full/10.22541/au.169521327.76672515</ext-link>).</p>
        </ack>
        <ref-list>
            <title>References</title>
            <ref id="ref1">
                <label>1</label>
                <mixed-citation publication-type="book">
                    <person-group person-group-type="author">

                        <name name-style="western">
                            <surname>M&#x00fa;nera</surname>
                            <given-names>M</given-names>
                        </name>

                        <name name-style="western">
                            <surname>Sanchez</surname>
                            <given-names>A</given-names>
                        </name>

                        <name name-style="western">
                            <surname>Buend&#x00ed;a</surname>
                            <given-names>E</given-names>
                        </name>

                        <etal/>
</person-group>:
                    <chapter-title>Autoantigens in atopic dermatitis: The characterization of autoantigens and their diagnostic value.</chapter-title>
                    <source>

                        <italic toggle="yes">Translational Autoimmunity.</italic>
</source>
                    <publisher-name>Elsevier</publisher-name>;<year>2023</year>; pp.<fpage>37</fpage>&#x2013;<lpage>48</lpage>.
                    <pub-id pub-id-type="doi">10.1016/B978-0-323-85389-7.00019-3</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref2">
                <label>2</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">

                        <name name-style="western">
                            <surname>McKenzie</surname>
                            <given-names>C</given-names>
                        </name>

                        <name name-style="western">
                            <surname>Silverberg</surname>
                            <given-names>JI</given-names>
                        </name>
</person-group>:
                    <article-title>The prevalence and persistence of atopic dermatitis in urban United States children.</article-title>
                    <source>

                        <italic toggle="yes">Ann. Allergy Asthma Immunol.</italic>
</source>
                    <year>2019</year>;<volume>123</volume>(<issue>2</issue>):<fpage>173</fpage>&#x2013;<lpage>178.e1</lpage>.
                    <pub-id pub-id-type="pmid">31128232</pub-id>
                    <pub-id pub-id-type="doi">10.1016/j.anai.2019.05.014</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref3">
                <label>3</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">

                        <name name-style="western">
                            <surname>Luger</surname>
                            <given-names>T</given-names>
                        </name>

                        <name name-style="western">
                            <surname>Amagai</surname>
                            <given-names>M</given-names>
                        </name>

                        <name name-style="western">
                            <surname>Dreno</surname>
                            <given-names>B</given-names>
                        </name>

                        <etal/>
</person-group>:
                    <article-title>Atopic dermatitis: Role of the skin barrier, environment, microbiome, and therapeutic agents.</article-title>
                    <source>

                        <italic toggle="yes">J. Dermatol. Sci.</italic>
</source>
                    <year>2021</year>;<volume>102</volume>(<issue>3</issue>):<fpage>142</fpage>&#x2013;<lpage>157</lpage>.
                    <pub-id pub-id-type="pmid">34116898</pub-id>
                    <pub-id pub-id-type="doi">10.1016/j.jdermsci.2021.04.007</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref4">
                <label>4</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">

                        <name name-style="western">
                            <surname>S&#x00e1;nchez</surname>
                            <given-names>J</given-names>
                        </name>

                        <name name-style="western">
                            <surname>Calvo</surname>
                            <given-names>V</given-names>
                        </name>

                        <name name-style="western">
                            <surname>S&#x00e1;nchez</surname>
                            <given-names>A</given-names>
                        </name>

                        <etal/>
</person-group>:
                    <article-title>Sensitization to 10 mites in a tropic area. Der p and Der f are important risk factor for sensitization to other mites from Pyroglyphidae, Acaridae, Chortoglyphidae, and Glyciphagidae families.</article-title>
                    <source>

                        <italic toggle="yes">Rev. Alerg. Mex.</italic>
</source>
                    <year>2017</year>;<volume>64</volume>(<issue>2</issue>):<fpage>153</fpage>&#x2013;<lpage>162</lpage>.
                    <pub-id pub-id-type="pmid">28658723</pub-id>
                    <pub-id pub-id-type="doi">10.29262/ram.v64i2.243</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref5">
                <label>5</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">

                        <name name-style="western">
                            <surname>Olsson</surname>
                            <given-names>M</given-names>
                        </name>

                        <name name-style="western">
                            <surname>Broberg</surname>
                            <given-names>A</given-names>
                        </name>

                        <name name-style="western">
                            <surname>Jern&#x00e5;s</surname>
                            <given-names>M</given-names>
                        </name>

                        <etal/>
</person-group>:
                    <article-title>Increased expression of aquaporin 3 in atopic eczema.</article-title>
                    <source>

                        <italic toggle="yes">Allergy.</italic>
</source>
                    <year>2006</year>;<volume>61</volume>(<issue>9</issue>):<fpage>1132</fpage>&#x2013;<lpage>1137</lpage>.
                    <pub-id pub-id-type="pmid">16918518</pub-id>
                    <pub-id pub-id-type="doi">10.1111/j.1398-9995.2006.01151.x</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref6">
                <label>6</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">

                        <name name-style="western">
                            <surname>S&#x00e1;nchez</surname>
                            <given-names>J</given-names>
                        </name>

                        <name name-style="western">
                            <surname>P&#x00e1;ez</surname>
                            <given-names>B</given-names>
                        </name>

                        <name name-style="western">
                            <surname>Mac&#x00ed;as-Weinmann</surname>
                            <given-names>A</given-names>
                        </name>

                        <etal/>
</person-group>:
                    <article-title>Puntos clave en el tratamiento de la dermatitis en Latinoam&#x00e9;rica. El Consenso SLAAI.</article-title>
                    <source>

                        <italic toggle="yes">Rev. Alerg. Mex.</italic>
</source>
                    <year>2015</year>;<volume>62</volume>(<issue>3</issue>):<fpage>226</fpage>&#x2013;<lpage>233</lpage>.
                    <pub-id pub-id-type="pmid">26239333</pub-id>
                    <pub-id pub-id-type="doi">10.29262/ram.v62i3.87</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref7">
                <label>7</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">

                        <name name-style="western">
                            <surname>Cardona</surname>
                            <given-names>R</given-names>
                        </name>

                        <name name-style="western">
                            <surname>S&#x00e1;nchez</surname>
                            <given-names>A</given-names>
                        </name>

                        <name name-style="western">
                            <surname>Larenas-Linnemann</surname>
                            <given-names>D</given-names>
                        </name>

                        <etal/>
</person-group>:
                    <article-title>Extractos alerg&#x00e9;nicos para inmunoterapia en Latinoam&#x00e9;rica.</article-title>
                    <source>

                        <italic toggle="yes">Rev. Alerg. Mex.</italic>
</source>
                    <year>2018</year>;<volume>65</volume>(<issue>1</issue>):<fpage>25</fpage>&#x2013;<lpage>40</lpage>.
                    <pub-id pub-id-type="pmid">29723939</pub-id>
                    <pub-id pub-id-type="doi">10.29262/ram.v65i1.287</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref8">
                <label>8</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">

                        <name name-style="western">
                            <surname>S&#x00e1;nchez</surname>
                            <given-names>J</given-names>
                        </name>

                        <name name-style="western">
                            <surname>S&#x00e1;nchez</surname>
                            <given-names>A</given-names>
                        </name>

                        <name name-style="western">
                            <surname>Cardona</surname>
                            <given-names>R</given-names>
                        </name>
</person-group>:
                    <article-title>Critical review of ISAAC results for atopic dermatitis in tropical cities.</article-title>
                    <source>

                        <italic toggle="yes">Rev. Alerg. Mex.</italic>
</source>
                    <year>2018</year>;<volume>65</volume>(<issue>4</issue>):<fpage>389</fpage>&#x2013;<lpage>399</lpage>.
                    <pub-id pub-id-type="pmid">30602209</pub-id>
                    <pub-id pub-id-type="doi">10.29262/ram.v65i4.341</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref9">
                <label>9</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">

                        <name name-style="western">
                            <surname>Celakovska</surname>
                            <given-names>J</given-names>
                        </name>

                        <name name-style="western">
                            <surname>Vankova</surname>
                            <given-names>R</given-names>
                        </name>

                        <name name-style="western">
                            <surname>Bukac</surname>
                            <given-names>J</given-names>
                        </name>

                        <etal/>
</person-group>:
                    <article-title>Atopic dermatitis and sensitisation to molecular components of alternaria, cladosporium, penicillium, aspergillus, and malassezia&#x2014;results of allergy explorer alex 2.</article-title>
                    <source>

                        <italic toggle="yes">J. Fungi.</italic>
</source>
                    <year>2021 Mar 1</year>;<volume>7</volume>(<issue>3</issue>):<fpage>1</fpage>&#x2013;<lpage>15</lpage>.
                    <pub-id pub-id-type="doi">10.3390/jof7030183</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref10">
                <label>10</label>
                <mixed-citation publication-type="book">
                    <person-group person-group-type="author">

                        <name name-style="western">
                            <surname>Glatz</surname>
                            <given-names>M</given-names>
                        </name>

                        <name name-style="western">
                            <surname>Bosshard</surname>
                            <given-names>P</given-names>
                        </name>

                        <name name-style="western">
                            <surname>Schmid-Grendelmeier</surname>
                            <given-names>P</given-names>
                        </name>
</person-group>:
                    <chapter-title>The Role of Fungi in Atopic Dermatitis.</chapter-title>
                    <source>

                        <italic toggle="yes">Immunology and Allergy Clinics of North America.</italic>
</source>
                    <publisher-name>W.B. Saunders</publisher-name>;<year>2017</year>; Vol.<volume>37</volume>: pp.<fpage>63</fpage>&#x2013;<lpage>74</lpage>.
                    <pub-id pub-id-type="doi">10.1016/j.iac.2016.08.012</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref11">
                <label>11</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">

                        <name name-style="western">
                            <surname>S&#x00e1;nchez</surname>
                            <given-names>P</given-names>
                        </name>

                        <name name-style="western">
                            <surname>V&#x00e9;lez-del-Burgo</surname>
                            <given-names>A</given-names>
                        </name>

                        <name name-style="western">
                            <surname>Su&#x00f1;&#x00e9;n</surname>
                            <given-names>E</given-names>
                        </name>

                        <etal/>
</person-group>:
                    <article-title>Fungal allergen and Mold allergy diagnosis: role and relevance of Alternaria alternata alt a 1 protein family.</article-title>
                    <source>

                        <italic toggle="yes">J. Fungi.</italic>
</source>
                    <year>2022</year>;<volume>8</volume>(<issue>3</issue>):<fpage>277</fpage>.
                    <pub-id pub-id-type="pmid">35330279</pub-id>
                    <pub-id pub-id-type="doi">10.3390/jof8030277</pub-id>
                    <pub-id pub-id-type="pmcid">PMC8954643</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref12">
                <label>12</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">

                        <name name-style="western">
                            <surname>Muthu</surname>
                            <given-names>V</given-names>
                        </name>

                        <name name-style="western">
                            <surname>Singh</surname>
                            <given-names>P</given-names>
                        </name>

                        <name name-style="western">
                            <surname>Choudhary</surname>
                            <given-names>H</given-names>
                        </name>

                        <etal/>
</person-group>:
                    <article-title>Role of recombinant Aspergillus fumigatus antigens in diagnosing Aspergillus sensitisation among asthmatics.</article-title>
                    <source>

                        <italic toggle="yes">Mycoses.</italic>
</source>
                    <year>2020</year>;<volume>63</volume>(<issue>9</issue>):<fpage>928</fpage>&#x2013;<lpage>936</lpage>.
                    <pub-id pub-id-type="doi">10.1111/myc.13124</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref13">
                <label>13</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">

                        <name name-style="western">
                            <surname>Disch</surname>
                            <given-names>R</given-names>
                        </name>

                        <name name-style="western">
                            <surname>Menz</surname>
                            <given-names>G</given-names>
                        </name>

                        <name name-style="western">
                            <surname>Biaser</surname>
                            <given-names>K</given-names>
                        </name>

                        <etal/>
</person-group>:
                    <article-title>Different Reactivity to Recombinant Aspergillus fumigatus Allergen l/a in Patients with Atopic Dermatitis or Allergic Asthma Sensitised to Aspergillus fumigatus.</article-title>
                    <source>

                        <italic toggle="yes">Int. Arch. Allergy Immunol.</italic>
</source>
                    <year>1995</year>;<volume>108</volume>(<issue>1</issue>):<fpage>89</fpage>&#x2013;<lpage>94</lpage>.
                    <pub-id pub-id-type="doi">10.1159/000237123</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref14">
                <label>14</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">

                        <name name-style="western">
                            <surname>Ikezoe</surname>
                            <given-names>K</given-names>
                        </name>

                        <name name-style="western">
                            <surname>Oga</surname>
                            <given-names>T</given-names>
                        </name>

                        <name name-style="western">
                            <surname>Honda</surname>
                            <given-names>T</given-names>
                        </name>

                        <etal/>
</person-group>:
                    <article-title>Aquaporin-3 potentiates allergic airway inflammation in ovalbumin-induced murine asthma.</article-title>
                    <source>

                        <italic toggle="yes">Sci. Rep.</italic>
</source>
                    <year>2016 May 11</year>;<volume>6</volume>.
                    <pub-id pub-id-type="pmid">27165276</pub-id>
                    <pub-id pub-id-type="doi">10.1038/srep25781</pub-id>
                    <pub-id pub-id-type="pmcid">PMC4863152</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref15">
                <label>15</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">

                        <name name-style="western">
                            <surname>Emiliani</surname>
                            <given-names>Y</given-names>
                        </name>

                        <name name-style="western">
                            <surname>S&#x00e1;nchez</surname>
                            <given-names>A</given-names>
                        </name>

                        <name name-style="western">
                            <surname>Munera</surname>
                            <given-names>M</given-names>
                        </name>

                        <etal/>
</person-group>:
                    <article-title>In silico analysis of cross reactivity among phospholipases from Hymenoptera species.</article-title>
                    <source>

                        <italic toggle="yes">F1000Res.</italic>
</source>
                    <year>2021 Jan 5</year>;<volume>10</volume>:<fpage>2</fpage>.
                    <pub-id pub-id-type="pmid">34046162</pub-id>
                    <pub-id pub-id-type="doi">10.12688/f1000research.27089.2</pub-id>
                    <pub-id pub-id-type="pmcid">PMC8129813</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref16">
                <label>16</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">

                        <name name-style="western">
                            <surname>Emiliani</surname>
                            <given-names>Y</given-names>
                        </name>

                        <name name-style="western">
                            <surname>Muzi</surname>
                            <given-names>G</given-names>
                        </name>

                        <name name-style="western">
                            <surname>S&#x00e1;nchez</surname>
                            <given-names>A</given-names>
                        </name>

                        <etal/>
</person-group>:
                    <article-title>Prediction of molecular mimicry between proteins from Trypanosoma sp. and human antigens associated with systemic lupus erythematosus.</article-title>
                    <source>

                        <italic toggle="yes">Microb. Pathog.</italic>
</source>
                    <year>2022 Nov 1</year>;<volume>172</volume>:<fpage>105760</fpage>.
                    <pub-id pub-id-type="pmid">36126789</pub-id>
                    <pub-id pub-id-type="doi">10.1016/j.micpath.2022.105760</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref17">
                <label>17</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">

                        <name name-style="western">
                            <surname>S&#x00e1;nchez</surname>
                            <given-names>A</given-names>
                        </name>

                        <name name-style="western">
                            <surname>Cardona</surname>
                            <given-names>R</given-names>
                        </name>

                        <name name-style="western">
                            <surname>Munera</surname>
                            <given-names>M</given-names>
                        </name>

                        <etal/>
</person-group>:
                    <article-title>Identification of antigenic epitopes of thyroperoxidase, thyroglobulin and interleukin-24. Exploration of cross-reactivity with environmental allergens and possible role in urticaria and hypothyroidism.</article-title>
                    <source>

                        <italic toggle="yes">Immunol. Lett.</italic>
</source>
                    <year>2020 Apr 1</year>;<volume>220</volume>:<fpage>71</fpage>&#x2013;<lpage>78</lpage>.
                    <pub-id pub-id-type="pmid">32027873</pub-id>
                    <pub-id pub-id-type="doi">10.1016/j.imlet.2020.02.003</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref18">
                <label>18</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">

                        <name name-style="western">
                            <surname>M&#x00fa;nera</surname>
                            <given-names>M</given-names>
                        </name>

                        <name name-style="western">
                            <surname>Farak</surname>
                            <given-names>J</given-names>
                        </name>

                        <name name-style="western">
                            <surname>P&#x00e9;rez</surname>
                            <given-names>M</given-names>
                        </name>

                        <etal/>
</person-group>:
                    <article-title>Prediction of molecular mimicry between antigens from Leishmania sp. and human: Implications for autoimmune response in systemic lupus erythematosus.</article-title>
                    <source>

                        <italic toggle="yes">Microb. Pathog.</italic>
</source>
                    <year>2020 Nov 1</year>;<volume>148</volume>:<fpage>104444</fpage>.
                    <pub-id pub-id-type="pmid">32827635</pub-id>
                    <pub-id pub-id-type="doi">10.1016/j.micpath.2020.104444</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref19">
                <label>19</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">

                        <name name-style="western">
                            <surname>S&#x00e1;nchez</surname>
                            <given-names>A</given-names>
                        </name>

                        <name name-style="western">
                            <surname>Cardona</surname>
                            <given-names>R</given-names>
                        </name>

                        <name name-style="western">
                            <surname>Munera</surname>
                            <given-names>M</given-names>
                        </name>

                        <etal/>
</person-group>:
                    <article-title>Identification of antigenic epitopes of thyroperoxidase, thyroglobulin and interleukin-24. Exploration of cross-reactivity with environmental allergens and possible role in urticaria and hypothyroidism.</article-title>
                    <source>

                        <italic toggle="yes">Immunol. Lett.</italic>
</source>
                    <year>2020 Apr 1</year>;<volume>220</volume>:<fpage>71</fpage>&#x2013;<lpage>78</lpage>.
                    <pub-id pub-id-type="pmid">32027873</pub-id>
                    <pub-id pub-id-type="doi">10.1016/j.imlet.2020.02.003</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref20">
                <label>20</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">

                        <name name-style="western">
                            <surname>Wang</surname>
                            <given-names>LL</given-names>
                        </name>

                        <name name-style="western">
                            <surname>Yu</surname>
                            <given-names>LL</given-names>
                        </name>

                        <name name-style="western">
                            <surname>Zhou</surname>
                            <given-names>Y</given-names>
                        </name>

                        <etal/>
</person-group>:
                    <article-title>Molecular Dynamics Simulations of Mite Aquaporin DerfAQP1 from the Dust Mite Dermatophagoides farinae (Acariformes: Pyroglyphidae).</article-title>
                    <source>

                        <italic toggle="yes">Biomed. Res. Int.</italic>
</source>
                    <year>2020</year>;<volume>2020</volume>:<fpage>1</fpage>&#x2013;<lpage>7</lpage>.
                    <pub-id pub-id-type="doi">10.1155/2020/6717390</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref21">
                <label>21</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">

                        <name name-style="western">
                            <surname>Le Mao</surname>
                            <given-names>J</given-names>
                        </name>

                        <name name-style="western">
                            <surname>Mayer</surname>
                            <given-names>CE</given-names>
                        </name>

                        <name name-style="western">
                            <surname>Peltre</surname>
                            <given-names>G</given-names>
                        </name>

                        <etal/>
</person-group>:
                    <article-title>Mapping of Dermatophagoides farinae mite allergens by two-dimensional immunoblotting.</article-title>
                    <source>

                        <italic toggle="yes">J. Allergy Clin. Immunol.</italic>
</source>
                    <year>1998</year>;<volume>102</volume>(<issue>4</issue>):<fpage>631</fpage>&#x2013;<lpage>636</lpage>.</mixed-citation>
            </ref>
            <ref id="ref22">
                <label>22</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">

                        <name name-style="western">
                            <surname>Celakovska</surname>
                            <given-names>J</given-names>
                        </name>

                        <name name-style="western">
                            <surname>Vankova</surname>
                            <given-names>R</given-names>
                        </name>

                        <name name-style="western">
                            <surname>Bukac</surname>
                            <given-names>J</given-names>
                        </name>

                        <etal/>
</person-group>:
                    <article-title>Atopic dermatitis and sensitisation to molecular components of alternaria, cladosporium, penicillium, aspergillus, and malassezia&#x2014;results of allergy explorer alex 2.</article-title>
                    <source>

                        <italic toggle="yes">J. Fungi.</italic>
</source>
                    <year>2021 Mar 1</year>;<volume>7</volume>(<issue>3</issue>):<fpage>1</fpage>&#x2013;<lpage>15</lpage>.
                    <pub-id pub-id-type="doi">10.3390/jof7030183</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref23">
                <label>23</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">

                        <name name-style="western">
                            <surname>Zhou</surname>
                            <given-names>Y</given-names>
                        </name>

                        <name name-style="western">
                            <surname>Li</surname>
                            <given-names>L</given-names>
                        </name>

                        <name name-style="western">
                            <surname>Qian</surname>
                            <given-names>J</given-names>
                        </name>

                        <etal/>
</person-group>:
                    <article-title>Identification of three aquaporin subgroups from Blomia tropicalis by transcriptomics.</article-title>
                    <source>

                        <italic toggle="yes">Int. J. Mol. Med.</italic>
</source>
                    <year>2018 Dec 1</year>;<volume>42</volume>(<issue>6</issue>):<fpage>3551</fpage>&#x2013;<lpage>3561</lpage>.
                    <pub-id pub-id-type="pmid">30221673</pub-id>
                    <pub-id pub-id-type="doi">10.3892/ijmm.2018.3877</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref24">
                <label>24</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">

                        <name name-style="western">
                            <surname>Ko&#x015f;alo&#x011f;lu-Yal&#x00e7;&#x0131;n</surname>
                            <given-names>Z</given-names>
                        </name>

                        <name name-style="western">
                            <surname>Lanka</surname>
                            <given-names>M</given-names>
                        </name>

                        <name name-style="western">
                            <surname>Frentzen</surname>
                            <given-names>A</given-names>
                        </name>

                        <etal/>
</person-group>:
                    <article-title>Predicting T cell recognition of MHC class I restricted neoepitopes.</article-title>
                    <source>

                        <italic toggle="yes">Onco Targets Ther.</italic>
</source>
                    <year>2018 Nov 2</year>;<volume>7</volume>(<issue>11</issue>).
                    <pub-id pub-id-type="doi">10.1080/2162402X.2018.1492508</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref25">
                <label>25</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">

                        <name name-style="western">
                            <surname>Sagan</surname>
                            <given-names>SA</given-names>
                        </name>

                        <name name-style="western">
                            <surname>Winger</surname>
                            <given-names>RC</given-names>
                        </name>

                        <name name-style="western">
                            <surname>Cruz-Herranz</surname>
                            <given-names>A</given-names>
                        </name>

                        <etal/>
</person-group>:
                    <article-title>Tolerance checkpoint bypass permits emergence of pathogenic T cells to neuromyelitis optica autoantigen aquaporin-4.</article-title>
                    <source>

                        <italic toggle="yes">Proc. Natl. Acad. Sci. USA.</italic>
</source>
                    <year>2016 Dec 20</year>;<volume>113</volume>(<issue>51</issue>):<fpage>14781</fpage>&#x2013;<lpage>14786</lpage>.
                    <pub-id pub-id-type="pmid">27940915</pub-id>
                    <pub-id pub-id-type="doi">10.1073/pnas.1617859114</pub-id>
                    <pub-id pub-id-type="pmcid">PMC5187685</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref26">
                <label>26</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">

                        <name name-style="western">
                            <surname>Ren</surname>
                            <given-names>Z</given-names>
                        </name>

                        <name name-style="western">
                            <surname>Wang</surname>
                            <given-names>Y</given-names>
                        </name>

                        <name name-style="western">
                            <surname>Duan</surname>
                            <given-names>T</given-names>
                        </name>

                        <etal/>
</person-group>:
                    <article-title>Cross-immunoreactivity between bacterial aquaporin-Z and human aquaporin-4: potential relevance to neuromyelitis optica.</article-title>
                    <source>

                        <italic toggle="yes">J. Immunol.</italic>
</source>
                    <year>2012</year>;<volume>189</volume>(<issue>9</issue>):<fpage>4602</fpage>&#x2013;<lpage>4611</lpage>.
                    <pub-id pub-id-type="pmid">23008451</pub-id>
                    <pub-id pub-id-type="doi">10.4049/jimmunol.1200486</pub-id>
                    <pub-id pub-id-type="pmcid">PMC3586280</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref27">
                <label>27</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">

                        <name name-style="western">
                            <surname>Cossu</surname>
                            <given-names>D</given-names>
                        </name>

                        <name name-style="western">
                            <surname>Yokoyama</surname>
                            <given-names>K</given-names>
                        </name>

                        <name name-style="western">
                            <surname>Tomizawa</surname>
                            <given-names>Y</given-names>
                        </name>

                        <etal/>
</person-group>:
                    <article-title>Altered humoral immunity to mycobacterial antigens in Japanese patients affected by inflammatory demyelinating diseases of the central nervous system.</article-title>
                    <source>

                        <italic toggle="yes">Sci. Rep.</italic>
</source>
                    <year>2017</year>;<volume>7</volume>(<issue>1</issue>):<fpage>3179</fpage>.
                    <pub-id pub-id-type="pmid">28600575</pub-id>
                    <pub-id pub-id-type="doi">10.1038/s41598-017-03370-z</pub-id>
                    <pub-id pub-id-type="pmcid">PMC5466620</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref28">
                <label>28</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">

                        <name name-style="western">
                            <surname>Munera</surname>
                            <given-names>M</given-names>
                        </name>

                        <name name-style="western">
                            <surname>Buend&#x00ed;a</surname>
                            <given-names>E</given-names>
                        </name>

                        <name name-style="western">
                            <surname>Sanchez</surname>
                            <given-names>A</given-names>
                        </name>

                        <etal/>
</person-group>:
                    <article-title>AQP4 as a vintage autoantigen: what do we know till now?</article-title>
                    <source>

                        <italic toggle="yes">Heliyon.</italic>
</source>
                    <year>2022</year>;<volume>8</volume>:<fpage>e12132</fpage>.
                    <pub-id pub-id-type="pmid">36506380</pub-id>
                    <pub-id pub-id-type="doi">10.1016/j.heliyon.2022.e12132</pub-id>
                    <pub-id pub-id-type="pmcid">PMC9730132</pub-id>
                </mixed-citation>
            </ref>
        </ref-list>
    </back>
    <sub-article article-type="reviewer-report" id="report297871">
        <front-stub>
            <article-id pub-id-type="doi">10.5256/f1000research.156440.r297871</article-id>
            <title-group>
                <article-title>Reviewer response for version 1</article-title>
            </title-group>
            <contrib-group>
                <contrib contrib-type="author">
                    <name>
                        <surname>Garcia</surname>
                        <given-names>Elizabeth</given-names>
                    </name>
                    <xref ref-type="aff" rid="r297871a1">1</xref>
                    <role>Referee</role>
                    <uri content-type="orcid">https://orcid.org/0000-0002-7456-4007</uri>
                </contrib>
                <aff id="r297871a1">
                    <label>1</label>Fundacion Santa Fe de Bogota, Bogot&#x00e1;, Bogota, Colombia</aff>
            </contrib-group>
            <author-notes>
                <fn fn-type="conflict">
                    <p>
                        <bold>Competing interests: </bold>No competing interests were disclosed.</p>
                </fn>
            </author-notes>
            <pub-date pub-type="epub">
                <day>24</day>
                <month>7</month>
                <year>2024</year>
            </pub-date>
            <permissions>
                <copyright-statement>Copyright: &#x00a9; 2024 Garcia E</copyright-statement>
                <copyright-year>2024</copyright-year>
                <license xlink:href="https://creativecommons.org/licenses/by/4.0/">
                    <license-p>This is an open access peer review report distributed under the terms of the Creative Commons Attribution Licence, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.</license-p>
                </license>
            </permissions>
            <related-article ext-link-type="doi" id="relatedArticleReport297871" related-article-type="peer-reviewed-article" xlink:href="10.12688/f1000research.142843.1"/>
            <custom-meta-group>
                <custom-meta>
                    <meta-name>recommendation</meta-name>
                    <meta-value>approve</meta-value>
                </custom-meta>
            </custom-meta-group>
        </front-stub>
        <body>
            <p>The present study offers key insights into the potential immunological cross-reactivity between human and fungal aquaporins. 
                <list list-type="bullet">
                    <list-item>
                        <p>Major highlights include the discovery of substantial sequence and structural homology, which indicates possible sites for cross-reactivity, and the epitope analysis that identified overlapping regions among proteins, suggesting mechanisms for immune response triggers. The allergenic potential of aquaporins from various sources extends the study's implications, indicating similar underlying mechanisms in various allergic conditions, specially atopic dermatitis. The innovative integration of bioinformatics tools provides a comprehensive view of molecular mimicry, setting a precedent for future studies. Clinically, identifying specific epitopes that contribute to cross-reactivity opens avenues for targeted therapies and diagnostic tools, enhancing allergy management and prevention.</p>
                    </list-item>
                    <list-item>
                        <p>Minor highlights include the rigorous methodology and the clear direction for future research, emphasizing experimental validation to confirm findings. This study, with its broad potential impact, notably contributes to understanding molecular mimicry in allergic diseases and sets the stage for future investigations in the field.</p>
                    </list-item>
                </list>
            </p>
            <p>Is the work clearly and accurately presented and does it cite the current literature?</p>
            <p>Yes</p>
            <p>If applicable, is the statistical analysis and its interpretation appropriate?</p>
            <p>Yes</p>
            <p>Is the study design appropriate and is the work technically sound?</p>
            <p>Yes</p>
            <p>Are the conclusions drawn adequately supported by the results?</p>
            <p>No</p>
            <p>Are sufficient details of methods and analysis provided to allow replication by others?</p>
            <p>Yes</p>
            <p>Reviewer Expertise:</p>
            <p>As an allergist and immunologist I have contributed to studies such as: &#x201c;Potential contribution of Helicobacter pylori proteins in the pathogenesis of type 1 gastric neuroendocrine tumor and urticaria. In silico approach. PLOS ONE | https://doi.org/10.1371/journal.pone.0281485. April 25, 2023</p>
            <p>I confirm that I have read this submission and believe that I have an appropriate level of expertise to confirm that it is of an acceptable scientific standard.</p>
        </body>
    </sub-article>
    <sub-article article-type="reviewer-report" id="report301819">
        <front-stub>
            <article-id pub-id-type="doi">10.5256/f1000research.156440.r301819</article-id>
            <title-group>
                <article-title>Reviewer response for version 1</article-title>
            </title-group>
            <contrib-group>
                <contrib contrib-type="author">
                    <name>
                        <surname>Olivier</surname>
                        <given-names>Celso Eduardo</given-names>
                    </name>
                    <xref ref-type="aff" rid="r301819a1">1</xref>
                    <role>Referee</role>
                </contrib>
                <aff id="r301819a1">
                    <label>1</label>American Institute Alergoimuno, Americana, Brazil</aff>
            </contrib-group>
            <author-notes>
                <fn fn-type="conflict">
                    <p>
                        <bold>Competing interests: </bold>No competing interests were disclosed.</p>
                </fn>
            </author-notes>
            <pub-date pub-type="epub">
                <day>13</day>
                <month>7</month>
                <year>2024</year>
            </pub-date>
            <permissions>
                <copyright-statement>Copyright: &#x00a9; 2024 Olivier CE</copyright-statement>
                <copyright-year>2024</copyright-year>
                <license xlink:href="https://creativecommons.org/licenses/by/4.0/">
                    <license-p>This is an open access peer review report distributed under the terms of the Creative Commons Attribution Licence, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.</license-p>
                </license>
            </permissions>
            <related-article ext-link-type="doi" id="relatedArticleReport301819" related-article-type="peer-reviewed-article" xlink:href="10.12688/f1000research.142843.1"/>
            <custom-meta-group>
                <custom-meta>
                    <meta-name>recommendation</meta-name>
                    <meta-value>approve-with-reservations</meta-value>
                </custom-meta>
            </custom-meta-group>
        </front-stub>
        <body>
            <p>It is a well-executed in-silico analysis comparing the amino acid sequences of human aquaporin 3&#x00a0; and 
                <italic>Aspergillus fumigatus</italic> aquaporin with 25</p>
            <p> aquaporins from various allergenic sources researched from the UniProt and NCBI databases. However, in "background," "introduction," and "discussion," the authors assume that the IgE antibody exclusively mediates allergic diseases and hypersensitivities mechanisms. Recently, at least seven types (with several subtypes) of hypersensitivity reactions were postulated. I suggest the authors peruse and pay attention to the following references in order to refer appropriately to the subject: [ref 1, 2].</p>
            <p>Is the work clearly and accurately presented and does it cite the current literature?</p>
            <p>Partly</p>
            <p>If applicable, is the statistical analysis and its interpretation appropriate?</p>
            <p>Not applicable</p>
            <p>Are all the source data underlying the results available to ensure full reproducibility?</p>
            <p>Yes</p>
            <p>Is the study design appropriate and is the work technically sound?</p>
            <p>Yes</p>
            <p>Are the conclusions drawn adequately supported by the results?</p>
            <p>Partly</p>
            <p>Are sufficient details of methods and analysis provided to allow replication by others?</p>
            <p>Yes</p>
            <p>Reviewer Expertise:</p>
            <p>Allergy and Immunology; non-IgE-mediated hypersensitivity</p>
            <p>I confirm that I have read this submission and believe that I have an appropriate level of expertise to confirm that it is of an acceptable scientific standard, however I have significant reservations, as outlined above.</p>
        </body>
        <back>
            <ref-list>
                <title>References</title>
                <ref id="rep-ref-301819-1">
                    <label>1</label>
                    <mixed-citation publication-type="journal">
                        <person-group person-group-type="author"/>:
                        <article-title>Nomenclature of allergic diseases and hypersensitivity reactions: Adapted to modern needs: An EAACI position paper.</article-title>
                        <source>
                            <italic>Allergy</italic>
                        </source>.<year>2023</year>;<volume>78</volume>(<issue>11</issue>) :
                        <elocation-id>10.1111/all.15889</elocation-id>
                        <fpage>2851</fpage>-<lpage>2874</lpage>
                        <pub-id pub-id-type="pmid">37814905</pub-id>
                        <pub-id pub-id-type="doi">10.1111/all.15889</pub-id>
                    </mixed-citation>
                </ref>
                <ref id="rep-ref-301819-2">
                    <label>2</label>
                    <mixed-citation>
                        <article-title>Contribution of the Leukocyte Adherence Inhibition Test in Diagnosing Non&#x2013;IgE-Mediated Immunoreactivity against Aspergillus fumigatus/authors</article-title>.</mixed-citation>
                </ref>
            </ref-list>
        </back>
    </sub-article>
</article>
