<?xml version="1.0" encoding="UTF-8"?><!DOCTYPE article PUBLIC "-//NLM//DTD JATS (Z39.96) Journal Publishing DTD v1.2 20190208//EN" "http://jats.nlm.nih.gov/publishing/1.2/JATS-journalpublishing1.dtd"><article xmlns:mml="http://www.w3.org/1998/Math/MathML" xmlns:xlink="http://www.w3.org/1999/xlink" article-type="research-article" dtd-version="1.2" xml:lang="en">
    <front>
        <journal-meta>
            <journal-id journal-id-type="pmc">F1000Research</journal-id>
            <journal-title-group>
                <journal-title>F1000Research</journal-title>
            </journal-title-group>
            <issn pub-type="epub">2046-1402</issn>
            <publisher>
                <publisher-name>F1000 Research Limited</publisher-name>
                <publisher-loc>London, UK</publisher-loc>
            </publisher>
        </journal-meta>
        <article-meta>
            <article-id pub-id-type="doi">10.12688/f1000research.5802.2</article-id>
            <article-categories>
                <subj-group subj-group-type="heading">
                    <subject>Research Article</subject>
                </subj-group>
                <subj-group>
                    <subject>Articles</subject>
                    <subj-group>
                        <subject>Antimicrobials &amp; Drug Resistance</subject>
                    </subj-group>
                    <subj-group>
                        <subject>Bioinformatics</subject>
                    </subj-group>
                    <subj-group>
                        <subject>Drug Discovery &amp; Design</subject>
                    </subj-group>
                    <subj-group>
                        <subject>Plant-Biotic Interactions</subject>
                    </subj-group>
                    <subj-group>
                        <subject>Protein Chemistry &amp; Proteomics</subject>
                    </subj-group>
                    <subj-group>
                        <subject>Small Molecule Chemistry</subject>
                    </subj-group>
                </subj-group>
            </article-categories>
            <title-group>
                <article-title>The PDB database is a rich source of alpha-helical anti-microbial peptides to combat disease causing pathogens</article-title>
                <fn-group content-type="pub-status">
                    <fn>
                        <p>[version 2; peer review: 2 approved, 1 approved with reservations]</p>
                    </fn>
                </fn-group>
            </title-group>
            <contrib-group>
                <contrib contrib-type="author" corresp="yes">
                    <name>
                        <surname>Chakraborty</surname>
                        <given-names>Sandeep</given-names>
                    </name>
                    <xref ref-type="corresp" rid="c1">a</xref>
                    <xref ref-type="aff" rid="a1">1</xref>
                    <xref ref-type="aff" rid="a2">2</xref>
                </contrib>
                <contrib contrib-type="author" corresp="no">
                    <name>
                        <surname>Phu</surname>
                        <given-names>My</given-names>
                    </name>
                    <xref ref-type="aff" rid="a1">1</xref>
                </contrib>
                <contrib contrib-type="author" corresp="no">
                    <name>
                        <surname>de Morais</surname>
                        <given-names>T&#x00e2;mara Prado</given-names>
                    </name>
                    <xref ref-type="aff" rid="a3">3</xref>
                </contrib>
                <contrib contrib-type="author" corresp="no">
                    <name>
                        <surname>Nascimento</surname>
                        <given-names>Rafael</given-names>
                    </name>
                    <xref ref-type="aff" rid="a4">4</xref>
                </contrib>
                <contrib contrib-type="author" corresp="no">
                    <name>
                        <surname>Goulart</surname>
                        <given-names>Luiz Ricardo</given-names>
                    </name>
                    <xref ref-type="aff" rid="a4">4</xref>
                </contrib>
                <contrib contrib-type="author" corresp="no">
                    <name>
                        <surname>Rao</surname>
                        <given-names>Basuthkar J.</given-names>
                    </name>
                    <xref ref-type="aff" rid="a2">2</xref>
                </contrib>
                <contrib contrib-type="author" corresp="no">
                    <name>
                        <surname>Asgeirsson</surname>
                        <given-names>Bjarni</given-names>
                    </name>
                    <xref ref-type="aff" rid="a5">5</xref>
                </contrib>
                <contrib contrib-type="author" corresp="no">
                    <name>
                        <surname>Dandekar</surname>
                        <given-names>Abhaya M.</given-names>
                    </name>
                    <xref ref-type="aff" rid="a1">1</xref>
                </contrib>
                <aff id="a1">
                    <label>1</label>Plant Sciences Department, University of California, Davis, CA, 95616, USA</aff>
                <aff id="a2">
                    <label>2</label>Department of Biological Sciences, Tata Institute of Fundamental Research, Homi Bhabha Road, Mumbai, 400 005, India</aff>
                <aff id="a3">
                    <label>3</label>Institute of Agricultural Sciences, Federal University of Uberlandia, Av. Amazonas, Bloco 2E, Campus Umuarama, Uberlandia, MG, Brazil</aff>
                <aff id="a4">
                    <label>4</label>Institute of Genetics and Biochemistry, Federal University of Uberlandia, Av. Amazonas, Bloco 2E, Campus Umuarama, Uberlandia, MG, Brazil</aff>
                <aff id="a5">
                    <label>5</label>Science Institute, Department of Biochemistry, University of Iceland, Dunhaga 3, IS-107 Reykjavik, Iceland</aff>
            </contrib-group>
            <author-notes>
                <corresp id="c1">
                    <label>a</label>
                    <email xlink:href="mailto:sanchak@ucdavis.edu">sanchak@ucdavis.edu</email>
                </corresp>
                <fn fn-type="con">
                    <p>SC wrote the computer programs. MP performed the 
                        <italic toggle="yes">in vitro</italic> experiments. All authors analyzed the data, and contributed equally to the writing and subsequent refinement of the manuscript.</p>
                </fn>
                <fn fn-type="conflict">
                    <p>
                        <bold>Competing interests: </bold>No competing interests were disclosed.</p>
                </fn>
            </author-notes>
            <pub-date pub-type="epub">
                <day>16</day>
                <month>6</month>
                <year>2015</year>
            </pub-date>
            <pub-date pub-type="collection">
                <year>2014</year>
            </pub-date>
            <volume>3</volume>
            <elocation-id>295</elocation-id>
            <history>
                <date date-type="accepted">
                    <day>11</day>
                    <month>6</month>
                    <year>2015</year>
                </date>
            </history>
            <permissions>
                <copyright-statement>Copyright: &#x00a9; 2015 Chakraborty S et al.</copyright-statement>
                <copyright-year>2015</copyright-year>
                <license xlink:href="https://creativecommons.org/licenses/by/4.0/">
                    <license-p>This is an open access article distributed under the terms of the Creative Commons Attribution Licence, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.</license-p>
                </license>
            </permissions>
            <self-uri content-type="pdf" xlink:href="https://f1000research.com/articles/3-295/pdf"/>
            <abstract>
                <p>The therapeutic potential of 
                    <italic toggle="yes">&#x03b1;</italic>-helical anti-microbial peptides (AH-AMP) to combat pathogens is fast gaining prominence. Based on recently published open access software for characterizing 
                    <italic toggle="yes">&#x03b1;</italic>-helical peptides (PAGAL), we elucidate a search methodology (SCALPEL) that leverages the massive structural data pre-existing in the PDB database to obtain AH-AMPs belonging to the host proteome. We provide 
                    <italic toggle="yes">in vitro</italic> validation of SCALPEL on plant pathogens (
                    <italic toggle="yes">Xylella fastidiosa</italic>, 
                    <italic toggle="yes">Xanthomonas arboricola</italic> and 
                    <italic toggle="yes">Liberibacter crescens</italic>) by identifying AH-AMPs that mirror the function and properties of cecropin B, a well-studied AH-AMP. The identified peptides include a linear AH-AMP present within the existing structure of phosphoenolpyruvate carboxylase (PPC20), and an AH-AMP mimicing the properties of the two 
                    <italic toggle="yes">&#x03b1;</italic>-helices of cecropin B from chitinase (CHITI25). The minimum inhibitory concentration of these peptides are comparable to that of cecropin B, while anionic peptides used as control failed to show any inhibitory effect on these pathogens. Substitute therapies in place of conventional chemotherapies using membrane permeabilizing peptides like these might also prove effective to target cancer cells. The use of native structures from the same organism could possibly ensure that administration of such peptides will be better tolerated and not elicit an adverse immune response. We suggest a similar approach to target Ebola epitopes, enumerated using PAGAL recently, by selecting suitable peptides from the human proteome, especially in wake of recent reports of cationic amphiphiles inhibiting virus entry and infection.</p>
            </abstract>
            <kwd-group kwd-group-type="author">
                <kwd>PDB database</kwd>
                <kwd>Ebola</kwd>
                <kwd>alpha-helical antimicrobial peptides</kwd>
                <kwd>SCALPEL</kwd>
            </kwd-group>
            <funding-group>
                <funding-statement>AMD wishes to acknowledge grant support from the California Department of Food and Agriculture PD/GWSS Board. BJ acknowledges financial support from Tata Institute of Fundamental Research (Department of Atomic Energy). Additionally, BJR is thankful to the Department of Science and Technology for the JC Bose Award Grant. BA acknowledges financial support from the Science Institute of the University of Iceland. TM acknowledges scholarship from CNPq - Brazil (Science Without Borders).</funding-statement>
            </funding-group>
        </article-meta>
        <notes>
            <sec sec-type="version-changes">
                <label>Revised</label>
                <title>Amendments from Version 1</title>
                <p>We have modified the manuscript based on the reviewers comments, especially with respect to clarifying two aspects a) The fact that peptides extracted from native proteins will not elicit an immune response is an hypothesis - and needs to be verified. b) The effectiveness of alpha helical peptides in combating cancer cells is not completely proven. We have also added three authors in this version based on their inputs to this work, they had been inadvertently excluded in the first version.</p>
            </sec>
        </notes>
    </front>
    <body>
        <sec sec-type="intro">
            <title>Introduction</title>
            <p>The abundance of alpha helical (AH) structures present within proteins bears testimony to their relevance in determining functionality
                <sup>
                    <xref ref-type="bibr" rid="ref-1">1</xref>
                </sup>. AHs are key components in protein-protein interaction interfaces
                <sup>
                    <xref ref-type="bibr" rid="ref-2">2</xref>
                </sup>, DNA binding motifs
                <sup>
                    <xref ref-type="bibr" rid="ref-3">3</xref>
                </sup>, proteins that permeate biological membranes
                <sup>
                    <xref ref-type="bibr" rid="ref-4">4</xref>
                </sup>, and anti-microbial peptides (AMP)
                <sup>
                    <xref ref-type="bibr" rid="ref-5">5</xref>,
                    <xref ref-type="bibr" rid="ref-6">6</xref>
                </sup>. Not surprisingly, these AHs are the targets for antibody binding
                <sup>
                    <xref ref-type="bibr" rid="ref-7">7</xref>,
                    <xref ref-type="bibr" rid="ref-8">8</xref>
                </sup> and therapeutic agents
                <sup>
                    <xref ref-type="bibr" rid="ref-9">9</xref>
                </sup>. These therapies in turn use AH peptides against both viral
                <sup>
                    <xref ref-type="bibr" rid="ref-10">10</xref>&#x2013;
                    <xref ref-type="bibr" rid="ref-12">12</xref>
                </sup> and bacterial pathogens
                <sup>
                    <xref ref-type="bibr" rid="ref-13">13</xref>
                </sup>.</p>
            <p>Some AHs have unique characteristics, which are strongly correlated to their significance in the function of a protein
                <sup>
                    <xref ref-type="bibr" rid="ref-7">7</xref>
                </sup>. For example, hydrophobic residues aligned on one surface (characterized by a hydrophobic moment
                <sup>
                    <xref ref-type="bibr" rid="ref-14">14</xref>
                </sup>), is critical for virus entry into host cells
                <sup>
                    <xref ref-type="bibr" rid="ref-15">15</xref>
                </sup>, and in the permeabilizing abilities of AH-AMPs
                <sup>
                    <xref ref-type="bibr" rid="ref-16">16</xref>
                </sup>. Often, AHs have cationic residues on the opposite side of the hydrophobic surface, which helps them target bacterial membranes
                <sup>
                    <xref ref-type="bibr" rid="ref-17">17</xref>,
                    <xref ref-type="bibr" rid="ref-18">18</xref>
                </sup>. We have previously implemented known methods
                <sup>
                    <xref ref-type="bibr" rid="ref-19">19</xref>
                </sup> of evaluating these properties, and provided this as open source software (PAGAL)
                <sup>
                    <xref ref-type="bibr" rid="ref-20">20</xref>
                </sup>. PAGAL was used to characterize the proteome of the Ebola virus
                <sup>
                    <xref ref-type="bibr" rid="ref-7">7</xref>
                </sup>, and to correlate the binding of the Ebola protein VP24
                <sup>
                    <xref ref-type="bibr" rid="ref-21">21</xref>
                </sup> to human karyopherin
                <sup>
                    <xref ref-type="bibr" rid="ref-22">22</xref>
                </sup> with the immune suppression and pathogenicity mechanisms of Ebola and Marburg viruses
                <sup>
                    <xref ref-type="bibr" rid="ref-23">23</xref>
                </sup>.</p>
            <p>Plant pathogens, like 
                <italic toggle="yes">Xylella fastidiosa</italic> (Xf)
                <sup>
                    <xref ref-type="bibr" rid="ref-24">24</xref>
                </sup>, 
                <italic toggle="yes">Xanthomonas arboricola</italic> (Xa)
                <sup>
                    <xref ref-type="bibr" rid="ref-25">25</xref>
                </sup> and 
                <italic toggle="yes">Liberibacter crescens</italic> (Lc)
                <sup>
                    <xref ref-type="bibr" rid="ref-26">26</xref>
                </sup> are a source of serious concern for economic
                <sup>
                    <xref ref-type="bibr" rid="ref-27">27</xref>
                </sup> and humanitarian reasons
                <sup>
                    <xref ref-type="bibr" rid="ref-28">28</xref>
                </sup>. Specifically, we have been involved in developing novel strategies to counter the Pierce&#x2019;s disease causing Xf, having previously designed a chimeric protein with anti-microbial properties that provides grapevines with enhanced resistance against Xf
                <sup>
                    <xref ref-type="bibr" rid="ref-29">29</xref>
                </sup>. Cecropin B (CECB) is the lytic component of this chimeric protein
                <sup>
                    <xref ref-type="bibr" rid="ref-30">30</xref>,
                    <xref ref-type="bibr" rid="ref-31">31</xref>
                </sup>. However, the non-nativeness of CECB raises concerns regarding its viability in practical applications
                <sup>
                    <xref ref-type="bibr" rid="ref-32">32</xref>
                </sup>.</p>
            <p>In an effort to replace CECB with an equivalent peptide from the grapevine/citrus genome, we present a design methodology to select AH-AMPs from any given genome - 
                <bold>S</bold>earch 
                <bold>c</bold>haracteristic 
                <bold>alp</bold>ha h
                <bold>el</bold>ical peptides in the PDB database and locate it in the genome (
                <bold>SCALPEL</bold>). CECB consist of two AHs, joined by a small loop. The N-terminal AH is cationic and hydrophobic, while the C-terminal AH consists of primarily hydrophobic residues. Characterizing all available AHs from plant proteins in the PDB database allowed us to identify a peptide with a large hydrophobic moment and a high proportion of positively charged residues, present in both grapevine and citrus (our organisms of interest), mirroring the linear cationic CECB N-terminal AH. One such match was a twenty residue long AH from phosphoenolpyruvate carboxylase in sunflower
                <sup>
                    <xref ref-type="bibr" rid="ref-33">33</xref>
                </sup>. The sequence of this peptide was used to find homologous peptides in the grapevine and citrus genome (PPC20). Subsequently, we used the SCALPEL algorithm to detect two contiguous AHs connected with a loop, mirroring the properties of CECB in a chitinase (CHITI25) from 
                <italic toggle="yes">Nicotiana tobaccum</italic> (PDBid:3ALG)
                <sup>
                    <xref ref-type="bibr" rid="ref-34">34</xref>
                </sup>. Subsequently, we demonstrate through bioassay experiments that PPC20 from the grapevine and citrus genome, and CHITI25 from the tobacco genome, inhibit 
                <italic toggle="yes">Xf</italic>, 
                <italic toggle="yes">Xa</italic> and 
                <italic toggle="yes">Lc</italic> growth. The minimum inhibitory concentration of these peptides are comparable to that of CECB, while anionic peptides used as controls failed to show any inhibitory effect with these pathogens. Further, we observed variation in the susceptibility of the pathogens to these peptides.</p>
        </sec>
        <sec sec-type="materials | methods">
            <title>Materials and methods</title>
            <sec>
                <title>
                    <italic toggle="yes">In silico</italic>&#x00a0;</title>
                <p>The PDB database was queried for the keyword &#x2018;plants&#x2019;, and proteins with the exact same sequences were removed. This resulted in a set of ~2000 proteins (see list.plants.txt in 
                    <xref ref-type="other" rid="DS0">Dataset 1</xref>). These proteins were analyzed using DSSP
                    <sup>
                        <xref ref-type="bibr" rid="ref-35">35</xref>
                    </sup> to identify the AHs, and AHs with the same sequence were removed. This resulted in ~6000 AHs (see ALPHAHELICES.zip in 
                    <xref ref-type="other" rid="DS0">Dataset 1</xref>). PAGAL was applied to this set of AHs (see RawDataHelix.txt in 
                    <xref ref-type="other" rid="DS0">Dataset 1</xref>). This data was refined to obtain peptides with different characteristics. We also computed the set of all pairs of AHs that are connected with a short (less than five residues) loop (see HTH in 
                    <xref ref-type="other" rid="DS0">Dataset 1</xref>). This set is used to extract a pair of AHs, such that one of them is cationic with a large hydrophobic moment, while the other comprises mostly of hydrophobic residues. The PAGAL algorithm has been detailed previously
                    <sup>
                        <xref ref-type="bibr" rid="ref-20">20</xref>
                    </sup>. Briefly, the Edmundson wheel is computed by considering a wheel with centre (0,0), radius 5, first residue coordinate (0,5) and advancing each subsequent residue by 100 degrees on the circle, as 3.6 turns of the helix makes one full circle. We compute the hydrophobic moment by connecting the center to the coordinate of the residue and give it a magnitude obtained from the hydrophobic scale (in our case, this scale is obtained from Jones 
                    <italic toggle="yes">et al.</italic>
                    <sup>
                        <xref ref-type="bibr" rid="ref-19">19</xref>
                    </sup>). These vectors are then added to obtain the final hydrophobic moment. The color coding for the Edmundson wheel is as follows: all hydrophobic residues are colored red, while hydrophilic residues are colored in blue: dark blue for positively charged residues, medium blue for negatively charged residues and light blue for amides. All protein structures were rendered by PyMol (
                    <ext-link ext-link-type="uri" xlink:href="http://www.pymol.org/">http://www.pymol.org/</ext-link>). The sequence alignment was done using ClustalW
                    <sup>
                        <xref ref-type="bibr" rid="ref-36">36</xref>
                    </sup>. The alignment images were generated using Seaview
                    <sup>
                        <xref ref-type="bibr" rid="ref-37">37</xref>
                    </sup>. Protein structures have been superimposed using MUSTANG
                    <sup>
                        <xref ref-type="bibr" rid="ref-38">38</xref>
                    </sup>.</p>
            </sec>
            <sec>
                <title>
                    <italic toggle="yes">In vitro</italic>&#x00a0;</title>
                <p>Synthesized chemical peptides were obtained from GenScript USA, Inc. The protein molecular weight was calculated per peptide then diluted to 2000
                    <italic toggle="yes">&#x00b5;</italic>M or 3000
                    <italic toggle="yes">&#x00b5;</italic>M stock solutions with phosphate buffered saline. Stock solutions were stored in -20&#x00b0;C and thawed on ice before use.</p>
                <p>Using the stock solutions, we made dilute solutions of 300
                    <italic toggle="yes">&#x00b5;</italic>M, 250
                    <italic toggle="yes">&#x00b5;</italic>M, 200
                    <italic toggle="yes">&#x00b5;</italic>M, 150
                    <italic toggle="yes">&#x00b5;</italic>M, 100
                    <italic toggle="yes">&#x00b5;</italic>M, 75
                    <italic toggle="yes">&#x00b5;</italic>M, 50
                    <italic toggle="yes">&#x00b5;</italic>M, 30
                    <italic toggle="yes">&#x00b5;</italic>M, 25
                    <italic toggle="yes">&#x00b5;</italic>M, and 10
                    <italic toggle="yes">&#x00b5;</italic>M to a final volume of 100
                    <italic toggle="yes">&#x00b5;</italic>l of phosphate buffered saline. Dilute peptide solutions were stored in -20&#x00b0;C and thawed on ice before use.</p>
                <p>
                    <italic toggle="yes">Xylella fastidosa</italic> 3A2 (PD3)
                    <sup>
                        <xref ref-type="bibr" rid="ref-39">39</xref>
                    </sup>, 
                    <italic toggle="yes">Xanthomonas arboricola</italic> 417 (TYS)
                    <sup>
                        <xref ref-type="bibr" rid="ref-40">40</xref>
                    </sup>, and 
                    <italic toggle="yes">Liberibacter crescens</italic> BT-1 (BM7)
                    <sup>
                        <xref ref-type="bibr" rid="ref-41">41</xref>
                    </sup> media were prepared and autoclaved at 121&#x00b0;C for 15&#x2013;30 minutes, then cooled and poured into 100 &#x00d7; 15mm sterile petri dishes. Kanamycin (50
                    <italic toggle="yes">&#x00b5;</italic>g/ml) was added to PD3.</p>
                <p>Bacteria were inoculated and allowed to grow in liquid medium at 28&#x00b0;C: 
                    <italic toggle="yes">Xf</italic> (5 days), 
                    <italic toggle="yes">Xa</italic> (3 days), and 
                    <italic toggle="yes">Lc</italic> (3 days) to reach the exponential phase. The inoculum was diluted to a working OD of 0.5 (1&#x00d7;10
                    <sup>7</sup> cells/ml). 10
                    <italic toggle="yes">&#x00b5;</italic>l of the OD 0.5 was plated with 90
                    <italic toggle="yes">&#x00b5;</italic>l of liquid media and spread on the pre-made agar plates to create a confluent lawn of bacteria. The bacteria were given an hour to set at room temperature. 10
                    <italic toggle="yes">&#x00b5;</italic>l of each peptide concentration was spotted onto a plate of agar preseeded with a layer of bacterium. After spotting the plates were incubated at 28&#x00b0;C for 2 to 10 days till zones of clearance were clearly visible and the plates were scored for the minimum inhibitory concentration (MIC) as that beyond which no visible clearance was observed. Data presented is in triplicate, and were identical.</p>
            </sec>
        </sec>
        <sec sec-type="results">
            <title>Results</title>
            <supplementary-material id="DS0" orientation="portrait" position="float" xlink:href="https://f1000researchdata.s3.amazonaws.com/datasets/5802/bd2e5aab-6e8f-448f-93c4-5b9701a7394e_SCALPELDATASET.zip">
                <label>Data used for SCALPEL search methodology to identify plant alpha helical - antimicrobial peptides in the PDB database</label>
                <caption>
                    <p>list.plants.txt: list of PDB IDs resulting from querying the PDB database with the keyword &#x2018;plant&#x2019;. ALPHAHELICES.zip: DSSP analysis of proteins listed in list.plants.txt to identify alpha helices. RawDataHelix.txt: PAGAL analysis of alpha helices listed in ALPHAHELICES.zip. HTH: Set of all pairs of alpha helices connected with a short (&lt;five residues) loop.</p>
                </caption>
            </supplementary-material>
            <sec>
                <title>Existing AH-AMPs: the positive controls</title>
                <p>Cecropin B (CECB) was used as a positive control, as it is known to target membrane surfaces and creates pores in the bacterial outer membrane
                    <sup>
                        <xref ref-type="bibr" rid="ref-30">30</xref>,
                        <xref ref-type="bibr" rid="ref-31">31</xref>
                    </sup>. CECB consists of an cationic amphipathic N-Terminal with a large hydrophobic moment (
                    <xref ref-type="fig" rid="f1">Figure 1a</xref>), and a C-Terminal comprising mostly of hydrophobic residues, which consequently has a low hydrophobic moment, (
                    <xref ref-type="fig" rid="f1">Figure 1b</xref>) joined by a short loop. Another positive control was a linear AH-AMP consisting of the residues 2-22 of the N-Terminal in CECB (CBNT21) (
                    <xref ref-type="fig" rid="f1">Figure 1a</xref>). The sequences of these are shown in 
                    <xref ref-type="table" rid="T1">Table 1</xref>.</p>
                <fig fig-type="figure" id="f1" orientation="portrait" position="float">
                    <label>Figure 1. </label>
                    <caption>
                        <title>Edmundson wheel for AHs in the known AMPs that were used as control.</title>
                        <p>The color coding for the Edmundson wheel is as follows: all hydrophobic residues are colored red, while hydrophilic residues are colored in blue: dark blue for positively charged residues, medium blue for negatively charged residues and light blue for amides. The hydrophobic moment arrow is not to scale. (
                            <bold>a</bold>) N-terminal of Cecropin B (CECB) shows its amphipathic nature, with one side being cationic and the other side hydrophobic. (
                            <bold>b</bold>) C-terminal of CECB consists of mostly hydrophobic residues, and thus has a low hydrophobic moment. (
                            <bold>c</bold>) Edmundson wheel for PPC20. (
                            <bold>d</bold>) Edmundson wheel for 3ALGA.
                            <italic toggle="yes">&#x03b1;</italic>4, which corresponds to the C-terminal of CECB and comprises mostly of hydrophobic residues (low hydrophobic moment). (
                            <bold>e</bold>) Edmundson wheel for 3ALGA.
                            <italic toggle="yes">&#x03b1;</italic>5, which corresponds to the cationic, N-terminal of CECB with a large hydrophobic moment.</p>
                    </caption>
                    <graphic orientation="portrait" position="float" xlink:href="https://f1000research-files.f1000.com/manuscripts/7108/5204120a-901b-485a-8166-63004e9e342f_figure1.gif"/>
                </fig>
                <table-wrap id="T1" orientation="portrait" position="anchor">
                    <label>Table 1. </label>
                    <caption>
                        <title>Sequences of peptides used in this study.</title>
                        <p>CO: control peptides SC: SCALPEL generated peptides.</p>
                    </caption>
                    <table content-type="article-table" frame="hsides">
                        <tbody>
                            <tr>
                                <td align="center" colspan="1" rowspan="1">CO</td>
                                <td align="center" colspan="1" rowspan="1">CECB</td>
                                <td align="center" colspan="1" rowspan="1">KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL
                                    <break/>full length CECB from 
                                    <italic toggle="yes">Hyalophora cecropia</italic> (silk moth)</td>
                            </tr>
                            <tr>
                                <td align="center" colspan="1" rowspan="1">CO</td>
                                <td align="center" colspan="1" rowspan="1">CBNT21</td>
                                <td align="center" colspan="1" rowspan="1">WKVFKKIEKMGRNIRNGIVKA
                                    <break/>N-terminal CECB (minus the first lysine)</td>
                            </tr>
                            <tr>
                                <td align="center" colspan="1" rowspan="1">SC</td>
                                <td align="center" colspan="1" rowspan="1">PPC20</td>
                                <td align="center" colspan="1" rowspan="1">TIWKGVPKFLRRVDTALKNI
                                    <break/>Linear cationic AH-AMP from phosphoenolpyruvate carboxylase (PDBid:3ZGBA)</td>
                            </tr>
                            <tr>
                                <td align="center" colspan="1" rowspan="1">SC</td>
                                <td align="center" colspan="1" rowspan="1">CHITI25</td>
                                <td align="center" colspan="1" rowspan="1">TAYGIMARQPNSRKSFIDSSIRLAR
                                    <break/>CECB like AH-AMP from chitinase 
                                    <italic toggle="yes">Nicotiana tobaccum</italic> (PDBid:3ALGA)</td>
                            </tr>
                            <tr>
                                <td align="center" colspan="1" rowspan="1">SC</td>
                                <td align="center" colspan="1" rowspan="1">ISS15</td>
                                <td align="center" colspan="1" rowspan="1">TLDELELFTDAVERW
                                    <break/>Linear anionic peptide from isoprene synthase from gray poplar (PDBid:3N0FA)</td>
                            </tr>
                        </tbody>
                    </table>
                </table-wrap>
            </sec>
            <sec>
                <title>SCALPEL: Identifying native AH-AMP peptides from the host proteome</title>
                <p>
                    <bold>
                        <italic toggle="yes">Linear AH-AMPs</italic>
                    </bold>. In order to choose a peptide mimicking CBNT21 (cationic, amphipathic, large hydrophobic moment), we directed our search to &#x2018;locate a small peptide with a large hydrophobic moment and a high proportion of positively charged residues&#x2019; on the raw data computed using PAGAL (See RawDataHelix.txt in 
                    <xref ref-type="other" rid="DS0">Dataset 1</xref>). A small peptide is essential for quick and cost effective iterations. 
                    <xref ref-type="table" rid="T2">Table 2</xref> shows the best matching AHs. Next, we used the sequence of these AHs to search the grapevine and citrus genomes, choosing only those that are present in both genomes. This allowed us to locate an AH from phosphoenolpyruvate carboxylase from sunflower, a key enzyme in the C4-photosynthetic carbon cycle which enhances solar conversion efficiency (PDBid:3ZGBA.
                    <italic toggle="yes">&#x03b1;</italic>11)
                    <sup>
                        <xref ref-type="bibr" rid="ref-33">33</xref>
                    </sup>. 
                    <xref ref-type="fig" rid="f2">Figure 2a</xref> shows the specific AH located within the protein structure, marked in green and blue. Although DSSP marks the whole peptide stretch as one AH, we chose the AH in blue due to the presence of a small 
                    <italic toggle="yes">&#x03c0;</italic> helix preceding that. We named this peptide PPC20 (
                    <xref ref-type="fig" rid="f2">Figure 2</xref>, 
                    <xref ref-type="table" rid="T1">Table 1</xref>). This peptide is fully conserved (100% identity in the 20 residues) in both grapevine (Accession id:XP_002285441) and citrus (Accession id:AGS12489.1). 
                    <xref ref-type="fig" rid="f2">Figure 2b,c</xref> shows the Pymol rendered AH surfaces of PPC20. The Asp259 stands out as a negative residue in an otherwise positive surface (
                    <xref ref-type="fig" rid="f2">Figure 2c</xref>). Since previous studies have noted dramatic transitions with a single mutation on the polar face, it would be interesting to find the effect of mutating Asp259 to a cationic residue
                    <sup>
                        <xref ref-type="bibr" rid="ref-42">42</xref>
                    </sup>.</p>
                <table-wrap id="T2" orientation="portrait" position="anchor">
                    <label>Table 2. </label>
                    <caption>
                        <title>Identifying AHs with cationic properties from plant proteins with known structures.</title>
                        <p>All AHs in plant proteins are analyzed using PAGAL, and the data is pruned for AHs with a high proportion of positive residues, and finally sorted based on their hydrophobic moment. The first match is present in both grapevine and citrus (PDBid:3ZGBA.
                            <italic toggle="yes">&#x03b1;</italic>11, which is a phosphoenolpyruvate carboxylase from sunflower). We ignored a small 
                            <italic toggle="yes">&#x03c0;</italic> AH in the beginning of this peptide comprising four residues. This peptide has been named PPC20. HM: Hydrophobic moment, RPNR: Relative proportion of positive residues among charged residues, Len: length of the 
                            <italic toggle="yes">&#x03b1;</italic>, NCH: number of charged residues.</p>
                    </caption>
                    <table content-type="article-table" frame="hsides">
                        <thead>
                            <tr>
                                <th align="center" colspan="1" rowspan="1">PDB.
                                    <italic toggle="yes">&#x03b1;</italic>
                                </th>
                                <th align="center" colspan="1" rowspan="1">Len</th>
                                <th align="center" colspan="1" rowspan="1">HM</th>
                                <th align="center" colspan="1" rowspan="1">RPNR</th>
                                <th align="center" colspan="1" rowspan="1">NCH</th>
                            </tr>
                        </thead>
                        <tbody>
                            <tr>
                                <td align="center" colspan="1" rowspan="1">3ZGBA.
                                    <italic toggle="yes">&#x03b1;</italic>11 (PPC20)</td>
                                <td align="center" colspan="1" rowspan="1">24</td>
                                <td align="center" colspan="1" rowspan="1">12.6</td>
                                <td align="center" colspan="1" rowspan="1">0.8</td>
                                <td align="center" colspan="1" rowspan="1">8</td>
                            </tr>
                            <tr>
                                <td align="center" colspan="1" rowspan="1">4HWIA.
                                    <italic toggle="yes">&#x03b1;</italic>10</td>
                                <td align="center" colspan="1" rowspan="1">17</td>
                                <td align="center" colspan="1" rowspan="1">12.3</td>
                                <td align="center" colspan="1" rowspan="1">0.9</td>
                                <td align="center" colspan="1" rowspan="1">9</td>
                            </tr>
                            <tr>
                                <td align="center" colspan="1" rowspan="1">4BXHB.
                                    <italic toggle="yes">&#x03b1;</italic>11</td>
                                <td align="center" colspan="1" rowspan="1">23</td>
                                <td align="center" colspan="1" rowspan="1">12.3</td>
                                <td align="center" colspan="1" rowspan="1">0.8</td>
                                <td align="center" colspan="1" rowspan="1">8</td>
                            </tr>
                            <tr>
                                <td align="center" colspan="1" rowspan="1">2J376.
                                    <italic toggle="yes">&#x03b1;</italic>1</td>
                                <td align="center" colspan="1" rowspan="1">18</td>
                                <td align="center" colspan="1" rowspan="1">10.5</td>
                                <td align="center" colspan="1" rowspan="1">0.9</td>
                                <td align="center" colspan="1" rowspan="1">8</td>
                            </tr>
                            <tr>
                                <td align="center" colspan="1" rowspan="1">3J61R.
                                    <italic toggle="yes">&#x03b1;</italic>4</td>
                                <td align="center" colspan="1" rowspan="1">21</td>
                                <td align="center" colspan="1" rowspan="1">10.4</td>
                                <td align="center" colspan="1" rowspan="1">0.9</td>
                                <td align="center" colspan="1" rowspan="1">10</td>
                            </tr>
                            <tr>
                                <td align="center" colspan="1" rowspan="1">3J60G.
                                    <italic toggle="yes">&#x03b1;</italic>3</td>
                                <td align="center" colspan="1" rowspan="1">44</td>
                                <td align="center" colspan="1" rowspan="1">10.2</td>
                                <td align="center" colspan="1" rowspan="1">0.8</td>
                                <td align="center" colspan="1" rowspan="1">22</td>
                            </tr>
                            <tr>
                                <td align="center" colspan="1" rowspan="1">1W07A.
                                    <italic toggle="yes">&#x03b1;</italic>4</td>
                                <td align="center" colspan="1" rowspan="1">21</td>
                                <td align="center" colspan="1" rowspan="1">9.9</td>
                                <td align="center" colspan="1" rowspan="1">0.8</td>
                                <td align="center" colspan="1" rowspan="1">10</td>
                            </tr>
                            <tr>
                                <td align="center" colspan="1" rowspan="1">2WWBM.
                                    <italic toggle="yes">&#x03b1;</italic>1</td>
                                <td align="center" colspan="1" rowspan="1">17</td>
                                <td align="center" colspan="1" rowspan="1">9.5</td>
                                <td align="center" colspan="1" rowspan="1">0.9</td>
                                <td align="center" colspan="1" rowspan="1">8</td>
                            </tr>
                            <tr>
                                <td align="center" colspan="1" rowspan="1">1B8GA.
                                    <italic toggle="yes">&#x03b1;</italic>17</td>
                                <td align="center" colspan="1" rowspan="1">27</td>
                                <td align="center" colspan="1" rowspan="1">7.3</td>
                                <td align="center" colspan="1" rowspan="1">0.9</td>
                                <td align="center" colspan="1" rowspan="1">11</td>
                            </tr>
                            <tr>
                                <td align="center" colspan="1" rowspan="1">3J61L.
                                    <italic toggle="yes">&#x03b1;</italic>1</td>
                                <td align="center" colspan="1" rowspan="1">19</td>
                                <td align="center" colspan="1" rowspan="1">7.2</td>
                                <td align="center" colspan="1" rowspan="1">1</td>
                                <td align="center" colspan="1" rowspan="1">9</td>
                            </tr>
                        </tbody>
                    </table>
                </table-wrap>
                <fig fig-type="figure" id="f2" orientation="portrait" position="float">
                    <label>Figure 2. </label>
                    <caption>
                        <title>Peptide PPC20 from phosphoenolpyruvate carboxylase in sunflower (PDBid:3ZGBA.
                            <italic toggle="yes">&#x03b1;</italic>11).</title>
                        <p>(
                            <bold>a</bold>) 3ZGBA.
                            <italic toggle="yes">&#x03b1;</italic>11 is marked in green and blue. We ignore the 
                            <italic toggle="yes">&#x03c0;</italic> AH, and also the small AH preceding it (marked in green). PPC20 is marked in blue. (
                            <bold>b</bold>) Hydrophobic surface of PPC20. (
                            <bold>c</bold>) Charged surface of PPC20. Asp259 stands out as a negative residue in an otherwise positive surface.</p>
                    </caption>
                    <graphic orientation="portrait" position="float" xlink:href="https://f1000research-files.f1000.com/manuscripts/7108/5204120a-901b-485a-8166-63004e9e342f_figure2.gif"/>
                </fig>
                <p>
                    <bold>
                        <italic toggle="yes">Non-linear AH-AMPs consisting of two AHs.</italic>
                    </bold> Next, we located two AHs within chitinase from 
                    <italic toggle="yes">Nicotiana tobaccum</italic> (PDBid:3ALGA.
                    <italic toggle="yes">&#x03b1;</italic>4 and 3ALGA.
                    <italic toggle="yes">&#x03b1;</italic>5)
                    <sup>
                        <xref ref-type="bibr" rid="ref-34">34</xref>
                    </sup> connected by a short random coil such that one of the AHs is cationic and hydrophobic, while the other AH is comprised mostly of hydrophobic, uncharged residues (CHITI25, 
                    <xref ref-type="fig" rid="f3">Figure 3a</xref>, 
                    <xref ref-type="table" rid="T1">Table 1</xref>). This peptide mimics the complete CECB protein (
                    <xref ref-type="fig" rid="f3">Figure 3b</xref>). While the properties of the AHs in CHITI25 is reversed from that of CECB, the order in which these AHs occur is not important for functionality. The multiple sequence alignment of CHITI25 from grapevine, citrus and tobacco is shown in 
                    <xref ref-type="fig" rid="f3">Figure 3c</xref>. CHITI25 from tobacco is the most cationic (five), followed by citrus (four) and grapevine (three). Thus, it is possible that the anti-microbial properties of CHITI25 from grapevine would be lower than CHITI25 from tobacco. These peptides can be subjected to mutations to enhance their natural anti-microbial properties in such a scenario
                    <sup>
                        <xref ref-type="bibr" rid="ref-43">43</xref>
                    </sup>.</p>
                <fig fig-type="figure" id="f3" orientation="portrait" position="float">
                    <label>Figure 3. </label>
                    <caption>
                        <title>Peptide CHITI25 from chitinase in tobacco (PDBid:3ALGA).</title>
                        <p>(
                            <bold>a</bold>) PDBid:3ALGA.
                            <italic toggle="yes">&#x03b1;</italic>4 in green, loop in magenta and 3ALGA.
                            <italic toggle="yes">&#x03b1;</italic>5 in blue. (
                            <bold>b</bold>) Superimposing CECB (PDBid:2IGRA) in red with CHITI25 in green using MUSTANG
                            <sup>
                                <xref ref-type="bibr" rid="ref-38">38</xref>
                            </sup>. Note, that the order of the AHs are reversed. (
                            <bold>c</bold>) Multiple sequence alignment of CHITI25 from grapevine (CHITIVit), citrus (CHITICit) and tobacco (CHITITob). CHITITob is the more cationic than CHITIVit or CHITICit.</p>
                    </caption>
                    <graphic orientation="portrait" position="float" xlink:href="https://f1000research-files.f1000.com/manuscripts/7108/5204120a-901b-485a-8166-63004e9e342f_figure3.gif"/>
                </fig>
                <p>
                    <bold>
                        <italic toggle="yes">Negative control - an anionic AH-AMP.</italic>
                    </bold> We also located an anionic AH-AMP using a similar strategy - a 13 residue peptide present within the structure of isoprene synthase from gray poplar (PDBid:3N0FA.
                    <italic toggle="yes">&#x03b1;</italic>18)
                    <sup>
                        <xref ref-type="bibr" rid="ref-44">44</xref>
                    </sup>. We also used phosphate buffered saline as a negative control. We have extended this helix on both terminals by including one adjacent residue from both terminals to obtain ISS15 (
                    <xref ref-type="table" rid="T1">Table 1</xref>).</p>
            </sec>
            <sec>
                <title>
                    <italic toggle="yes">In vitro</italic> results</title>
                <p>We have validated our peptides using plating assays (
                    <xref ref-type="table" rid="T3">Table 3</xref>, 
                    <xref ref-type="fig" rid="f4">Figure 4</xref>). CECB, the well-established AH-AMP, is the most potent among all the peptides tested, having minimum inhibitory concentrations of between 25
                    <italic toggle="yes">&#x00b5;</italic>M (for 
                    <italic toggle="yes">Xa</italic>) to 100
                    <italic toggle="yes">&#x00b5;</italic>M (for 
                    <italic toggle="yes">Xf</italic> and 
                    <italic toggle="yes">Lc</italic>). This shows the variations in susceptibilities of different organisms. Understanding this differential susceptibility would require a deeper understanding of the underlying mechanism by which these AH-AMPs work
                    <sup>
                        <xref ref-type="bibr" rid="ref-45">45</xref>
                    </sup>, as well as the difference in the membrane composition of these gram-negative pathogens
                    <sup>
                        <xref ref-type="bibr" rid="ref-46">46</xref>
                    </sup>. Mostly, CBNT21 has a slightly lower potency, indicating a role for the C-terminal AH in CECB, which comprises of mostly hydrophobic residues for 
                    <italic toggle="yes">Xf</italic> and 
                    <italic toggle="yes">Lc</italic>. This results corroborates a plausible mechanism suggested by others in which the anionic membranes of bacteria is targeted by the cationic N-terminal, and followed by the insertion of the C-terminal AH into the hydrophobic membrane creating a pore. PPC20 and CHITI25 have comparable potencies with CECB and CBNT21, although 
                    <italic toggle="yes">Lc</italic> appears to be resistant to CHITI25. Finally, the anionic peptide used as a negative control shows no effect on these pathogens.</p>
                <table-wrap id="T3" orientation="portrait" position="anchor">
                    <label>Table 3. </label>
                    <caption>
                        <title>Minimum Inhibitory Concentration of peptides tested (
                            <italic toggle="yes">&#x00b5;</italic>M).</title>
                        <p>It can be seen that CECB is the most efficient among all the peptides for all three pathogens, while the anionic ISS15 does not show any effect even at higher concentrations. However, while CHITI25 is almost as effective as CECB for 
                            <italic toggle="yes">Xf</italic>, it fails to inhibit 
                            <italic toggle="yes">Lc</italic> growth. Also, 
                            <italic toggle="yes">Xa</italic> is much more susceptible to these peptides compared to the other two pathogens. Finally, the anionic ISS15 has no effect on these pathogens. Data is in triplicate, and were identical.</p>
                    </caption>
                    <table content-type="article-table" frame="hsides">
                        <thead>
                            <tr>
                                <th colspan="1" rowspan="1"/>
                                <th colspan="1" rowspan="1">Bacteria</th>
                                <th colspan="1" rowspan="1">CECB</th>
                                <th colspan="1" rowspan="1">CBNT21</th>
                                <th colspan="1" rowspan="1">PPC20</th>
                                <th colspan="1" rowspan="1">CHITI25</th>
                                <th colspan="1" rowspan="1">ISS15</th>
                            </tr>
                        </thead>
                        <tbody>
                            <tr>
                                <td colspan="1" rowspan="1">
                                    <italic toggle="yes">&#x03b3;</italic> Proteobacteria</td>
                                <td align="center" colspan="1" rowspan="1">
                                    <italic toggle="yes">Xylella fastidiosa</italic> 3A2 (
                                    <italic toggle="yes">Xf</italic>)
                                    <break/>
                                    <italic toggle="yes">Xanthomonas arboricola</italic> 417 (
                                    <italic toggle="yes">Xa</italic>)</td>
                                <td align="center" colspan="1" rowspan="1">100
                                    <break/>25</td>
                                <td align="center" colspan="1" rowspan="1">200
                                    <break/>25</td>
                                <td align="center" colspan="1" rowspan="1">150
                                    <break/>50</td>
                                <td align="center" colspan="1" rowspan="1">100
                                    <break/>150</td>
                                <td align="center" colspan="1" rowspan="1">&gt;300
                                    <break/>&gt;300</td>
                            </tr>
                            <tr>
                                <td colspan="1" rowspan="1">
                                    <italic toggle="yes">&#x03b1;</italic> Proteobacteria</td>
                                <td align="center" colspan="1" rowspan="1">
                                    <italic toggle="yes">Liberibacter crescens</italic> BT-1 (
                                    <italic toggle="yes">Lc</italic>)</td>
                                <td align="center" colspan="1" rowspan="1">100</td>
                                <td align="center" colspan="1" rowspan="1">200</td>
                                <td align="center" colspan="1" rowspan="1">200</td>
                                <td align="center" colspan="1" rowspan="1">&gt;300</td>
                                <td align="center" colspan="1" rowspan="1">&gt;300</td>
                            </tr>
                        </tbody>
                    </table>
                </table-wrap>
                <fig fig-type="figure" id="f4" orientation="portrait" position="float">
                    <label>Figure 4. </label>
                    <caption>
                        <title>
							
                            <italic toggle="yes">In vitro</italic> validation of SCALPEL methodology.</title>
                        <p>Plating assay to determine minimum inhibitory concentration (MIC) of SCALPEL identified peptides for 
                            <italic toggle="yes">Xanthomonas arboricola</italic>. Counter-clockwise: 300
                            <italic toggle="yes">&#x00b5;</italic>M, 250
                            <italic toggle="yes">&#x00b5;</italic>M, 200
                            <italic toggle="yes">&#x00b5;</italic>M, 150
                            <italic toggle="yes">&#x00b5;</italic>M, 100
                            <italic toggle="yes">&#x00b5;</italic>M 75
                            <italic toggle="yes">&#x00b5;</italic>M, 50
                            <italic toggle="yes">&#x00b5;</italic>M, 30
                            <italic toggle="yes">&#x00b5;</italic>M, 25
                            <italic toggle="yes">&#x00b5;</italic>M, 10
                            <italic toggle="yes">&#x00b5;</italic>M, PBS. CECB: MIC 25, CBNT2: MIC 10, PPC20: MIC 50, CHITI25: MIC 150, ISS15: MIC &gt;300.</p>
                    </caption>
                    <graphic orientation="portrait" position="float" xlink:href="https://f1000research-files.f1000.com/manuscripts/7108/5204120a-901b-485a-8166-63004e9e342f_figure4.gif"/>
                </fig>
            </sec>
        </sec>
        <sec sec-type="discussion">
            <title>Discussion</title>
            <p>The repertoire of defense proteins available to an organism is being constantly reshaped through genomic changes that confer resistance to pathogens. Genetic approaches aim at achieving the same goal of enhancing immunity through rational design of peptides
                <sup>
                    <xref ref-type="bibr" rid="ref-13">13</xref>,
                    <xref ref-type="bibr" rid="ref-47">47</xref>
                </sup>, which are then incorporated into the genome
                <sup>
                    <xref ref-type="bibr" rid="ref-29">29</xref>,
                    <xref ref-type="bibr" rid="ref-31">31</xref>,
                    <xref ref-type="bibr" rid="ref-48">48</xref>
                </sup>. Also, it is important to ensure that these non-endogenous genomic fragments have minimal effect on humans for their commercial viability
                <sup>
                    <xref ref-type="bibr" rid="ref-32">32</xref>
                </sup>. Identifying peptides from the same genome helps allay these concerns to a significant extent. The key innovation of the current work is the ability to identify peptides with specific properties (cationic AHs with a hydrophobic surface, linear or otherwise) from the genome of any organism of interest. Such peptides also present less likelihood of eliciting an adverse immune response from the host.</p>
            <sec>
                <title>Alternate methods</title>
                <p>Alternate computational methods for finding such new AMPs based on known AMPs could be of two kinds, although neither method is as effective in obtaining our results. Firstly, a sequence search using BLAST can be done to find a corresponding peptide in the genome, say for cecropin B. However, a BLAST of the cecropin sequence does not give any significant matches in the grapevine or citrus genomes, and is a dead end. In principle, what we need is a peptide with cecropin B like properties - and that information is not encoded in the linear sequence, but in the Edmundson wheel of the AH. The second method for such a search is to find structural homology in the PDB database through a tool like DALILITE
                    <sup>
                        <xref ref-type="bibr" rid="ref-49">49</xref>
                    </sup>. However, AHs are almost indistinguishable structurally, and the results will give rise to many redundancies. Thus, there are no existing methods tailored to incorporate the quantifiable properties of AHs in the search. We, for the first time, have proposed such a method in SCALPEL.</p>
                <p>Computer-assisted design strategies have also been applied in designing 
                    <italic toggle="yes">de novo</italic> AMPs
                    <sup>
                        <xref ref-type="bibr" rid="ref-50">50</xref>,
                        <xref ref-type="bibr" rid="ref-51">51</xref>
                    </sup>. Other hand curated comprehensive databases for &#x2018;for storing, classifying, searching, predicting, and designing potent peptides against pathogenic bacteria, viruses, fungi, parasites, and cancer cells&#x2019;
                    <sup>
                        <xref ref-type="bibr" rid="ref-52">52</xref>
                    </sup> do not enjoy the automation and vastness of available data elucidated in the SCALPEL methodology.</p>
            </sec>
            <sec>
                <title>Limitations and future directions</title>
                <p>There are several caveats to our study. We are yet to ascertain the hemolytic nature of the identified peptides, and will be performing these experiments in the near future. In fact, the selective cytotoxicity against human cancer cells, might be used as a substitute therapy in place of conventional chemotherapy
                    <sup>
                        <xref ref-type="bibr" rid="ref-53">53</xref>,
                        <xref ref-type="bibr" rid="ref-54">54</xref>
                    </sup>. It must be noted that the development of a selective peptide with anti-cancer cell properties has been a challenge
                    <sup>
                        <xref ref-type="bibr" rid="ref-55">55</xref>
                    </sup>. Although, we have not measured the lipid permeabilizing abilities of our peptides, a recent study has found that potency in permeabilizing bacteria-like lipid vesicles does not correlate with significant improvements in antimicrobial activity, rendering such measurements redundant
                    <sup>
                        <xref ref-type="bibr" rid="ref-56">56</xref>
                    </sup>. The electrostatic context of an peptide is known to have a significant bearing on its propensity to adopt an AH structure. The ability to predict the folding of peptides requires significant computational power and modelling expertise
                    <sup>
                        <xref ref-type="bibr" rid="ref-57">57</xref>
                    </sup>. Peptides often remain in random coil conformations, and achieve helical structures only by interacting with anionic membrane models
                    <sup>
                        <xref ref-type="bibr" rid="ref-58">58</xref>
                    </sup>. It is also possible to measure peptide helicity through circular dichroism spectroscopy
                    <sup>
                        <xref ref-type="bibr" rid="ref-59">59</xref>
                    </sup>. However, our results have been all positive based on selected choices of peptides arising from our search results, and suggest a high likelihood of getting anti-microbial activity from these peptides. Additionally, we may have to resort to other innovative techniques that have been previously adopted to overcome thermodynamic instability or proteolytic susceptibility
                    <sup>
                        <xref ref-type="bibr" rid="ref-60">60</xref>&#x2013;
                        <xref ref-type="bibr" rid="ref-63">63</xref>
                    </sup>.</p>
            </sec>
        </sec>
        <sec sec-type="conclusions">
            <title>Conclusion</title>
            <p>To summarize, we establish the presence of a large number of AH-AMPs &#x2018;hidden&#x2019; in the universal proteome. We have designed a methodology to extract such peptides from the PDB database - the &#x2018;Big Data&#x2019; center in proteomics. We demonstrate our results on well known plant pathogens - 
                <italic toggle="yes">Xf, Xa</italic> and 
                <italic toggle="yes">Lc</italic>. The feasibility of using such peptides in cancer therapies is also strong
                <sup>
                    <xref ref-type="bibr" rid="ref-54">54</xref>,
                    <xref ref-type="bibr" rid="ref-64">64</xref>
                </sup>. The ability to choose a peptide from the host itself is an invaluable asset, since nativeness of the peptide allays fears of eliciting a negative immune response upon administration. The problem of antibiotic resistance is also increasing focus on peptide based therapies
                <sup>
                    <xref ref-type="bibr" rid="ref-9">9</xref>,
                    <xref ref-type="bibr" rid="ref-65">65</xref>
                </sup>, since it is &#x2018;an enigma that bacteria have not developed highly effective cationic AMP-resistance mechanisms&#x2019;
                <sup>
                    <xref ref-type="bibr" rid="ref-66">66</xref>
                </sup>. Lastly, in face of the current Ebola outbreak
                <sup>
                    <xref ref-type="bibr" rid="ref-67">67</xref>,
                    <xref ref-type="bibr" rid="ref-68">68</xref>
                </sup>, we strongly suggest the possibility of developing peptides derived from the human genome to target viral epitopes, such as those enumerated for the Ebola virus recently
                <sup>
                    <xref ref-type="bibr" rid="ref-7">7</xref>
                </sup>. A recent study has reported the inhibition of the Ebola virus entry and infection by several cationic amphiphiles
                <sup>
                    <xref ref-type="bibr" rid="ref-69">69</xref>
                </sup>, suggesting the SCALPEL generated cationic peptides with the aid of cell penetrating peptides
                <sup>
                    <xref ref-type="bibr" rid="ref-70">70</xref>
                </sup> could achieve similar results.</p>
        </sec>
    </body>
    <back>
        <sec>
            <title>Data availability</title>
            <p>F1000Research: Dataset 1. Data used for SCAPEL search methodology to identify plant alpha helical - antimicrobial peptides in the PDB database, 
                <ext-link ext-link-type="uri" xlink:href="http://dx.doi.org/10.5256/f1000research.5802.d39823">10.5256/f1000research.5802.d39823</ext-link>
                <sup>
                    <xref ref-type="bibr" rid="ref-71">71</xref>
                </sup>
            </p>
        </sec>
        <ack>
            <title>Acknowledgements</title>
            <p>The pathogen strains used in our study were kindly provided by Steven E. Lindow, University of California, Berkeley (
                <italic toggle="yes">Xylella fastidiosa</italic> 3A2), James E. Adaskaveg, University of California, Riverside (
                <italic toggle="yes">Xanthomonas arboricola</italic> 417) and Eric Triplett, University of Florida, Gainesville (
                <italic toggle="yes">Liberibacter crescens</italic> BT-1).</p>
        </ack>
        <ref-list>
            <ref id="ref-1">
                <label>1</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">
						
                        <name name-style="western">
                            <surname>Azzarito</surname>
                            <given-names>V</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Long</surname>
                            <given-names>K</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Murphy</surname>
                            <given-names>NS</given-names>
                        </name>
						
                        <etal/>
					</person-group>:
                    <article-title>Inhibition of &#x03b1;-helix-mediated protein-protein interactions using designed molecules.</article-title>
                    <source>
						
                        <italic toggle="yes">Nat Chem.</italic>
					</source>
                    <year>2013</year>;<volume>5</volume>(<issue>3</issue>):<fpage>161</fpage>&#x2013;<lpage>173</lpage>.
                    <pub-id pub-id-type="pmid">23422557</pub-id>
                    <pub-id pub-id-type="doi">10.1038/nchem.1568</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref-2">
                <label>2</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">
						
                        <name name-style="western">
                            <surname>Lee</surname>
                            <given-names>JH</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Zhang</surname>
                            <given-names>Q</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Jo</surname>
                            <given-names>S</given-names>
                        </name>
						
                        <etal/>
					</person-group>:
                    <article-title>Novel pyrrolopyrimidine-based &#x03b1;-helix mimetics: cell-permeable inhibitors of protein&#x2013;protein interactions.</article-title>
                    <source>
						
                        <italic toggle="yes">J Am Chem Soc.</italic>
					</source>
                    <year>2011</year>;<volume>133</volume>(<issue>4</issue>):<fpage>676</fpage>&#x2013;<lpage>679</lpage>.
                    <pub-id pub-id-type="pmid">21171592</pub-id>
                    <pub-id pub-id-type="doi">10.1021/ja108230s</pub-id>
                    <pub-id pub-id-type="pmcid">3079198</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref-3">
                <label>3</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">
						
                        <name name-style="western">
                            <surname>Landschulz</surname>
                            <given-names>WH</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Johnson</surname>
                            <given-names>PF</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>McKnight</surname>
                            <given-names>SL</given-names>
                        </name>
					</person-group>:
                    <article-title>The leucine zipper: a hypothetical structure common to a new class of DNA binding proteins.</article-title>
                    <source>
						
                        <italic toggle="yes">Science.</italic>
					</source>
                    <year>1988</year>;<volume>240</volume>(<issue>4860</issue>):<fpage>1759</fpage>&#x2013;<lpage>1764</lpage>.
                    <pub-id pub-id-type="pmid">3289117</pub-id>
                    <pub-id pub-id-type="doi">10.1126/science.3289117</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref-4">
                <label>4</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">
						
                        <name name-style="western">
                            <surname>Dathe</surname>
                            <given-names>M</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Wieprecht</surname>
                            <given-names>T</given-names>
                        </name>
					</person-group>:
                    <article-title>Structural features of helical antimicrobial peptides: their potential to modulate activity on model membranes and biological cells.</article-title>
                    <source>
						
                        <italic toggle="yes">Biochim Biophys Acta.</italic>
					</source>
                    <year>1999</year>;<volume>1462</volume>(<issue>1&#x2013;2</issue>):<fpage>71</fpage>&#x2013;<lpage>87</lpage>.
                    <pub-id pub-id-type="pmid">10590303</pub-id>
                    <pub-id pub-id-type="doi">10.1016/S0005-2736(99)00201-1</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref-5">
                <label>5</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">
						
                        <name name-style="western">
                            <surname>Wang</surname>
                            <given-names>G</given-names>
                        </name>
					</person-group>:
                    <article-title>Structures of human host defense cathelicidin LL-37 and its smallest antimicrobial peptide KR-12 in lipid micelles.</article-title>
                    <source>
						
                        <italic toggle="yes">J Biol Chem.</italic>
					</source>
                    <year>2008</year>;<volume>283</volume>(<issue>47</issue>):<fpage>32637</fpage>&#x2013;<lpage>32643</lpage>.
                    <pub-id pub-id-type="pmid">18818205</pub-id>
                    <pub-id pub-id-type="doi">10.1074/jbc.M805533200</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref-6">
                <label>6</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">
						
                        <name name-style="western">
                            <surname>Wang</surname>
                            <given-names>G</given-names>
                        </name>
					</person-group>:
                    <article-title>Human antimicrobial peptides and proteins.</article-title>
                    <source>
						
                        <italic toggle="yes">Pharmaceuticals (Basel).</italic>
					</source>
                    <year>2014</year>;<volume>7</volume>(<issue>5</issue>):<fpage>545</fpage>&#x2013;<lpage>594</lpage>.
                    <pub-id pub-id-type="pmid">24828484</pub-id>
                    <pub-id pub-id-type="doi">10.3390/ph7050545</pub-id>
                    <pub-id pub-id-type="pmcid">4035769</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref-7">
                <label>7</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">
						
                        <name name-style="western">
                            <surname>Chakraborty</surname>
                            <given-names>S</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Rao</surname>
                            <given-names>BJ</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Asgeirsson</surname>
                            <given-names>B</given-names>
                        </name>
						
                        <etal/>
					</person-group>:
                    <article-title>Characterizing alpha helical properties of Ebola viral proteins as potential targets for inhibition of alpha-helix mediated protein-protein interactions [v3; ref status: indexed, 
                        <ext-link ext-link-type="uri" xlink:href="http://f1000r.es/50u">http://f1000r.es/50u</ext-link>].</article-title>
                    <source>
						
                        <italic toggle="yes">F1000Res.</italic>
					</source>
                    <year>2014</year>;<volume>3</volume>:<fpage>251</fpage>.
                    <pub-id pub-id-type="pmid">25717367</pub-id>
                    <pub-id pub-id-type="doi">10.12688/f1000research.5573.3</pub-id>
                    <pub-id pub-id-type="pmcid">4329671</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref-8">
                <label>8</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">
						
                        <name name-style="western">
                            <surname>Lee</surname>
                            <given-names>JE</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Fusco</surname>
                            <given-names>ML</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Hessell</surname>
                            <given-names>AJ</given-names>
                        </name>
						
                        <etal/>
					</person-group>:
                    <article-title>Structure of the Ebola virus glycoprotein bound to an antibody from a human survivor.</article-title>
                    <source>
						
                        <italic toggle="yes">Nature.</italic>
					</source>
                    <year>2008</year>;<volume>454</volume>(<issue>7201</issue>):<fpage>177</fpage>&#x2013;<lpage>182</lpage>.
                    <pub-id pub-id-type="pmid">18615077</pub-id>
                    <pub-id pub-id-type="doi">10.1038/nature07082</pub-id>
                    <pub-id pub-id-type="pmcid">2700032</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref-9">
                <label>9</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">
						
                        <name name-style="western">
                            <surname>Hancock</surname>
                            <given-names>RE</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Chapple</surname>
                            <given-names>DS</given-names>
                        </name>
					</person-group>:
                    <article-title>Peptide antibiotics.</article-title>
                    <source>
						
                        <italic toggle="yes">Antimicrob Agents Chemother.</italic>
					</source>
                    <year>1999</year>;<volume>43</volume>(<issue>6</issue>):<fpage>1317</fpage>&#x2013;<lpage>1323</lpage>.
                    <pub-id pub-id-type="pmid">10348745</pub-id>
                    <pub-id pub-id-type="pmcid">89271</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref-10">
                <label>10</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">
						
                        <name name-style="western">
                            <surname>Judice</surname>
                            <given-names>JK</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Tom</surname>
                            <given-names>JY</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Huang</surname>
                            <given-names>W</given-names>
                        </name>
						
                        <etal/>
					</person-group>:
                    <article-title>Inhibition of HIV type 1 infectivity by constrained alpha-helical peptides: implications for the viral fusion mechanism.</article-title>
                    <source>
						
                        <italic toggle="yes">Proc Natl Acad Sci U S A.</italic>
					</source>
                    <year>1997</year>;<volume>94</volume>(<issue>25</issue>):<fpage>13426</fpage>&#x2013;<lpage>13430</lpage>.
                    <pub-id pub-id-type="pmid">9391041</pub-id>
                    <pub-id pub-id-type="doi">10.1073/pnas.94.25.13426</pub-id>
                    <pub-id pub-id-type="pmcid">28321</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref-11">
                <label>11</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">
						
                        <name name-style="western">
                            <surname>Champagne</surname>
                            <given-names>K</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Shishido</surname>
                            <given-names>A</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Root</surname>
                            <given-names>MJ</given-names>
                        </name>
					</person-group>:
                    <article-title>Interactions of HIV-1 inhibitory peptide T20 with the gp41 N-HR coiled coil.</article-title>
                    <source>
						
                        <italic toggle="yes">J Biol Chem.</italic>
					</source>
                    <year>2009</year>;<volume>284</volume>(<issue>6</issue>):<fpage>3619</fpage>&#x2013;<lpage>3627</lpage>.
                    <pub-id pub-id-type="pmid">19073602</pub-id>
                    <pub-id pub-id-type="doi">10.1074/jbc.M809269200</pub-id>
                    <pub-id pub-id-type="pmcid">2635040</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref-12">
                <label>12</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">
						
                        <name name-style="western">
                            <surname>Hong</surname>
                            <given-names>W</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Li</surname>
                            <given-names>T</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Song</surname>
                            <given-names>Y</given-names>
                        </name>
						
                        <etal/>
					</person-group>:
                    <article-title>Inhibitory activity and mechanism of two scorpion venom peptides against herpes simplex virus type 1.</article-title>
                    <source>
						
                        <italic toggle="yes">Antiviral Res.</italic>
					</source>
                    <year>2014</year>;<volume>102</volume>:<fpage>1</fpage>&#x2013;<lpage>10</lpage>.
                    <pub-id pub-id-type="pmid">24315793</pub-id>
                    <pub-id pub-id-type="doi">10.1016/j.antiviral.2013.11.013</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref-13">
                <label>13</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">
						
                        <name name-style="western">
                            <surname>Zeitler</surname>
                            <given-names>B</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Herrera Diaz</surname>
                            <given-names>A</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Dangel</surname>
                            <given-names>A</given-names>
                        </name>
						
                        <etal/>
					</person-group>:
                    <article-title>De-novo design of antimicrobial peptides for plant protection.</article-title>
                    <source>
						
                        <italic toggle="yes">PLoS One.</italic>
					</source>
                    <year>2013</year>;<volume>8</volume>(<issue>8</issue>):<fpage>e71687</fpage>.
                    <pub-id pub-id-type="pmid">23951222</pub-id>
                    <pub-id pub-id-type="doi">10.1371/journal.pone.0071687</pub-id>
                    <pub-id pub-id-type="pmcid">3741113</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref-14">
                <label>14</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">
						
                        <name name-style="western">
                            <surname>Eisenberg</surname>
                            <given-names>D</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Weiss</surname>
                            <given-names>RM</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Terwilliger</surname>
                            <given-names>TC</given-names>
                        </name>
					</person-group>:
                    <article-title>The helical hydrophobic moment: a measure of the amphiphilicity of a helix.</article-title>
                    <source>
						
                        <italic toggle="yes">Nature.</italic>
					</source>
                    <year>1982</year>;<volume>299</volume>(<issue>5881</issue>):<fpage>371</fpage>&#x2013;<lpage>374</lpage>.
                    <pub-id pub-id-type="pmid">7110359</pub-id>
                    <pub-id pub-id-type="doi">10.1038/299371a0</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref-15">
                <label>15</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">
						
                        <name name-style="western">
                            <surname>Badani</surname>
                            <given-names>H</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Garry</surname>
                            <given-names>RF</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Wimley</surname>
                            <given-names>WC</given-names>
                        </name>
					</person-group>:
                    <article-title>Peptide entry inhibitors of enveloped viruses: the importance of interfacial hydrophobicity.</article-title>
                    <source>
						
                        <italic toggle="yes">Biochim Biophys Acta.</italic>
					</source>
                    <year>2014</year>;<volume>1838</volume>(<issue>9</issue>):<fpage>2180</fpage>&#x2013;<lpage>2197</lpage>.
                    <pub-id pub-id-type="pmid">24780375</pub-id>
                    <pub-id pub-id-type="doi">10.1016/j.bbamem.2014.04.015</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref-16">
                <label>16</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">
						
                        <name name-style="western">
                            <surname>Chen</surname>
                            <given-names>Y</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Guarnieri</surname>
                            <given-names>MT</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Vasil</surname>
                            <given-names>AI</given-names>
                        </name>
						
                        <etal/>
					</person-group>:
                    <article-title>Role of peptide hydrophobicity in the mechanism of action of alpha-helical antimicrobial peptides.</article-title>
                    <source>
						
                        <italic toggle="yes">Antimicrob Agents Chemother.</italic>
					</source>
                    <year>2007</year>;<volume>51</volume>(<issue>4</issue>):<fpage>1398</fpage>&#x2013;<lpage>1406</lpage>.
                    <pub-id pub-id-type="pmid">17158938</pub-id>
                    <pub-id pub-id-type="doi">10.1128/AAC.00925-06</pub-id>
                    <pub-id pub-id-type="pmcid">1855469</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref-17">
                <label>17</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">
						
                        <name name-style="western">
                            <surname>Brogden</surname>
                            <given-names>KA</given-names>
                        </name>
					</person-group>:
                    <article-title>Antimicrobial peptides: pore formers or metabolic inhibitors in bacteria?</article-title>
                    <source>
						
                        <italic toggle="yes">Nat Rev Microbiol.</italic>
					</source>
                    <year>2005</year>;<volume>3</volume>(<issue>3</issue>):<fpage>238</fpage>&#x2013;<lpage>250</lpage>.
                    <pub-id pub-id-type="pmid">15703760</pub-id>
                    <pub-id pub-id-type="doi">10.1038/nrmicro1098</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref-18">
                <label>18</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">
						
                        <name name-style="western">
                            <surname>Huang</surname>
                            <given-names>Y</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Huang</surname>
                            <given-names>J</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Chen</surname>
                            <given-names>Y</given-names>
                        </name>
					</person-group>:
                    <article-title>Alpha-helical cationic antimicrobial peptides: relationships of structure and function.</article-title>
                    <source>
						
                        <italic toggle="yes">Protein Cell.</italic>
					</source>
                    <year>2010</year>;<volume>1</volume>(<issue>2</issue>):<fpage>143</fpage>&#x2013;<lpage>152</lpage>.
                    <pub-id pub-id-type="pmid">21203984</pub-id>
                    <pub-id pub-id-type="doi">10.1007/s13238-010-0004-3</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref-19">
                <label>19</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">
						
                        <name name-style="western">
                            <surname>Jones</surname>
                            <given-names>MK</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Anantharamaiah</surname>
                            <given-names>GM</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Segrest</surname>
                            <given-names>JP</given-names>
                        </name>
					</person-group>:
                    <article-title>Computer programs to identify and classify amphipathic alpha helical domains.</article-title>
                    <source>
						
                        <italic toggle="yes">J Lipid Res.</italic>
					</source>
                    <year>1992</year>;<volume>33</volume>(<issue>2</issue>):<fpage>287</fpage>&#x2013;<lpage>296</lpage>.
                    <pub-id pub-id-type="pmid">1569380</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref-20">
                <label>20</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">
						
                        <name name-style="western">
                            <surname>Chakraborty</surname>
                            <given-names>S</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Rao</surname>
                            <given-names>B</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Dandekar</surname>
                            <given-names>A</given-names>
                        </name>
					</person-group>:
                    <article-title>PAGAL - Properties and corresponding graphics of alpha helical structures in proteins. [v2; ref status: indexed, 
                        <ext-link ext-link-type="uri" xlink:href="http://f1000r.es/4e7">http://f1000r.es/4e7</ext-link>].</article-title>
                    <source>
						
                        <italic toggle="yes">F1000Res.</italic>
					</source>
                    <year>2014</year>;<volume>3</volume>:<lpage>206</lpage>.
                    <pub-id pub-id-type="pmid">25352981</pub-id>
                    <pub-id pub-id-type="doi">10.12688/f1000research.4952.2</pub-id>
                    <pub-id pub-id-type="pmcid">4207245</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref-21">
                <label>21</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">
						
                        <name name-style="western">
                            <surname>Zhang</surname>
                            <given-names>AP</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Abelson</surname>
                            <given-names>DM</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Bornholdt</surname>
                            <given-names>ZA</given-names>
                        </name>
						
                        <etal/>
					</person-group>:
                    <article-title>The ebolavirus VP24 interferon antagonist: know your enemy.</article-title>
                    <source>
						
                        <italic toggle="yes">Virulence.</italic>
					</source>
                    <year>2012</year>;<volume>3</volume>(<issue>5</issue>):<fpage>440</fpage>&#x2013;<lpage>5</lpage>.
                    <pub-id pub-id-type="pmid">23076242</pub-id>
                    <pub-id pub-id-type="doi">10.4161/viru.21302</pub-id>
                    <pub-id pub-id-type="pmcid">3485981</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref-22">
                <label>22</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">
						
                        <name name-style="western">
                            <surname>Xu</surname>
                            <given-names>W</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Edwards</surname>
                            <given-names>MR</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Borek</surname>
                            <given-names>DM</given-names>
                        </name>
						
                        <etal/>
					</person-group>:
                    <article-title>Ebola virus VP24 targets a unique NLS binding site on karyopherin alpha 5 to selectively compete with nuclear import of phosphorylated STAT1.</article-title>
                    <source>
						
                        <italic toggle="yes">Cell Host Microbe.</italic>
					</source>
                    <year>2014</year>;<volume>16</volume>(<issue>2</issue>):<fpage>187</fpage>&#x2013;<lpage>200</lpage>.
                    <pub-id pub-id-type="pmid">25121748</pub-id>
                    <pub-id pub-id-type="doi">10.1016/j.chom.2014.07.008</pub-id>
                    <pub-id pub-id-type="pmcid">4188415</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref-23">
                <label>23</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">
						
                        <name name-style="western">
                            <surname>Chakraborty</surname>
                            <given-names>S</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Rao</surname>
                            <given-names>B</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Asgeirsson</surname>
                            <given-names>B</given-names>
                        </name>
						
                        <etal/>
					</person-group>:
                    <article-title>Correlating the ability of VP24 protein from Ebola and Marburg viruses to bind human karyopherin to their immune suppression mechanism and pathogenicity using computational methods [v1; ref status: approved with reservations 1, 
                        <ext-link ext-link-type="uri" xlink:href="http://f1000r.es/4o3">http://f1000r.es/4o3</ext-link>].</article-title>
                    <source>
						
                        <italic toggle="yes">F1000Res.</italic>
					</source>
                    <year>2014</year>;<volume>3</volume>:<fpage>265</fpage>.
                    <pub-id pub-id-type="doi">10.12688/f1000research.5666.1</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref-24">
                <label>24</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">
						
                        <name name-style="western">
                            <surname>Hopkins</surname>
                            <given-names>DL</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Purcell</surname>
                            <given-names>AH</given-names>
                        </name>
					</person-group>:
                    <article-title>
						
                        <italic toggle="yes">Xylella fastidiosa</italic>: cause of Pierce&#x2019;s disease of grapevine and other emergent diseases.</article-title>
                    <source>
						
                        <italic toggle="yes">Plant Disease.</italic>
					</source>
                    <year>2002</year>;<volume>86</volume>:<fpage>1056</fpage>&#x2013;<lpage>1066</lpage>.
                    <pub-id pub-id-type="doi">10.1094/PDIS.2002.86.10.1056</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref-25">
                <label>25</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">
						
                        <name name-style="western">
                            <surname>Ryan</surname>
                            <given-names>RP</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Vorh&#x00f6;lter</surname>
                            <given-names>FJ</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Potnis</surname>
                            <given-names>N</given-names>
                        </name>
						
                        <etal/>
					</person-group>:
                    <article-title>Pathogenomics of 
                        <italic toggle="yes">Xanthomonas</italic>: understanding bacterium-plant interactions.</article-title>
                    <source>
						
                        <italic toggle="yes">Nat Rev Microbiol.</italic>
					</source>
                    <year>2011</year>;<volume>9</volume>(<issue>5</issue>):<fpage>344</fpage>&#x2013;<lpage>355</lpage>.
                    <pub-id pub-id-type="pmid">21478901</pub-id>
                    <pub-id pub-id-type="doi">10.1038/nrmicro2558</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref-26">
                <label>26</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">
						
                        <name name-style="western">
                            <surname>Leonard</surname>
                            <given-names>MT</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Fagen</surname>
                            <given-names>JR</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Davis-Richardson</surname>
                            <given-names>AG</given-names>
                        </name>
						
                        <etal/>
					</person-group>:
                    <article-title>Complete genome sequence of 
                        <italic toggle="yes">Liberibacter crescens</italic> BT-1.</article-title>
                    <source>
						
                        <italic toggle="yes">Stand Genomic Sci.</italic>
					</source>
                    <year>2012</year>;<volume>7</volume>(<issue>2</issue>):<fpage>271</fpage>&#x2013;<lpage>283</lpage>.
                    <pub-id pub-id-type="pmid">23408754</pub-id>
                    <pub-id pub-id-type="doi">10.4056/sigs.3326772</pub-id>
                    <pub-id pub-id-type="pmcid">3569387</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref-27">
                <label>27</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">
						
                        <name name-style="western">
                            <surname>Alston</surname>
                            <given-names>JM</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Fuller</surname>
                            <given-names>KB</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Kaplan</surname>
                            <given-names>JD</given-names>
                        </name>
						
                        <etal/>
					</person-group>:
                    <article-title>Assessing the returns to r&amp;d on perennial crops: the costs and benefits of Pierce&#x2019;s disease research in the California winegrape industry.</article-title>
                    <source>
						
                        <italic toggle="yes">Aust J Agric Resour Econ.</italic>
					</source>
                    <year>2014</year>.
                    <pub-id pub-id-type="doi">10.1111/1467-8489.12045</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref-28">
                <label>28</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">
						
                        <name name-style="western">
                            <surname>Strange</surname>
                            <given-names>RN</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Scott</surname>
                            <given-names>PR</given-names>
                        </name>
					</person-group>:
                    <article-title>Plant disease: a threat to global food security.</article-title>
                    <source>
						
                        <italic toggle="yes">Annu Rev Phytopathol.</italic>
					</source>
                    <year>2005</year>;<volume>43</volume>:<fpage>83</fpage>&#x2013;<lpage>116</lpage>.
                    <pub-id pub-id-type="pmid">16078878</pub-id>
                    <pub-id pub-id-type="doi">10.1146/annurev.phyto.43.113004.133839</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref-29">
                <label>29</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">
						
                        <name name-style="western">
                            <surname>Dandekar</surname>
                            <given-names>AM</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Gouran</surname>
                            <given-names>H</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Ib&#x00e1;nez</surname>
                            <given-names>AM</given-names>
                        </name>
						
                        <etal/>
					</person-group>:
                    <article-title>An engineered innate immune defense protects grapevines from Pierce disease.</article-title>
                    <source>
						
                        <italic toggle="yes">Proc Natl Acad Sci U S A.</italic>
					</source>
                    <year>2012</year>;<volume>109</volume>(<issue>10</issue>):<fpage>3721</fpage>&#x2013;<lpage>3725</lpage>.
                    <pub-id pub-id-type="pmid">22355130</pub-id>
                    <pub-id pub-id-type="doi">10.1073/pnas.1116027109</pub-id>
                    <pub-id pub-id-type="pmcid">3309795</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref-30">
                <label>30</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">
						
                        <name name-style="western">
                            <surname>Moore</surname>
                            <given-names>AJ</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Beazley</surname>
                            <given-names>WD</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Bibby</surname>
                            <given-names>MC</given-names>
                        </name>
						
                        <etal/>
					</person-group>:
                    <article-title>Antimicrobial activity of cecropins.</article-title>
                    <source>
						
                        <italic toggle="yes">J Antimicrob Chemother.</italic>
					</source>
                    <year>1996</year>;<volume>37</volume>(<issue>6</issue>):<fpage>1077</fpage>&#x2013;<lpage>1089</lpage>.
                    <pub-id pub-id-type="pmid">8836811</pub-id>
                    <pub-id pub-id-type="doi">10.1093/jac/37.6.1077</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref-31">
                <label>31</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">
						
                        <name name-style="western">
                            <surname>Sharma</surname>
                            <given-names>A</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Sharma</surname>
                            <given-names>R</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Imamura</surname>
                            <given-names>M</given-names>
                        </name>
						
                        <etal/>
					</person-group>:
                    <article-title>Transgenic expression of cecropin B, an antibacterial peptide from 
                        <italic toggle="yes">Bombyx mori</italic>, confers enhanced resistance to bacterial leaf blight in rice.</article-title>
                    <source>
						
                        <italic toggle="yes">FEBS Lett.</italic>
					</source>
                    <year>2000</year>;<volume>484</volume>(<issue>1</issue>):<fpage>7</fpage>&#x2013;<lpage>11</lpage>.
                    <pub-id pub-id-type="pmid">11056212</pub-id>
                    <pub-id pub-id-type="doi">10.1016/S0014-5793(00)02106-2</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref-32">
                <label>32</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">
						
                        <name name-style="western">
                            <surname>Shelton</surname>
                            <given-names>AM</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Zhao</surname>
                            <given-names>JZ</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Roush</surname>
                            <given-names>RT</given-names>
                        </name>
					</person-group>:
                    <article-title>Economic, ecological, food safety, and social consequences of the deployment of bt transgenic plants.</article-title>
                    <source>
						
                        <italic toggle="yes">Annu Rev Entomol.</italic>
					</source>
                    <year>2002</year>;<volume>47</volume>:<fpage>845</fpage>&#x2013;<lpage>881</lpage>.
                    <pub-id pub-id-type="pmid">11729093</pub-id>
                    <pub-id pub-id-type="doi">10.1146/annurev.ento.47.091201.145309</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref-33">
                <label>33</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">
						
                        <name name-style="western">
                            <surname>Paulus</surname>
                            <given-names>JK</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Schlieper</surname>
                            <given-names>D</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Groth</surname>
                            <given-names>G</given-names>
                        </name>
					</person-group>:
                    <article-title>Greater efficiency of photosynthetic carbon fixation due to single amino-acid substitution.</article-title>
                    <source>
						
                        <italic toggle="yes">Nat Commun.</italic>
					</source>
                    <year>2013</year>;<volume>4</volume>:<fpage>1518</fpage>.
                    <pub-id pub-id-type="pmid">23443546</pub-id>
                    <pub-id pub-id-type="doi">10.1038/ncomms2504</pub-id>
                    <pub-id pub-id-type="pmcid">3586729</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref-34">
                <label>34</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">
						
                        <name name-style="western">
                            <surname>Ohnuma</surname>
                            <given-names>T</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Numata</surname>
                            <given-names>T</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Osawa</surname>
                            <given-names>T</given-names>
                        </name>
						
                        <etal/>
					</person-group>:
                    <article-title>Crystal structure and mode of action of a class V chitinase from 
                        <italic toggle="yes">Nicotiana tabacum</italic>.</article-title>
                    <source>
						
                        <italic toggle="yes">Plant Mol Biol.</italic>
					</source>
                    <year>2011</year>;<volume>75</volume>(<issue>3</issue>):<fpage>291</fpage>&#x2013;<lpage>304</lpage>.
                    <pub-id pub-id-type="pmid">21240541</pub-id>
                    <pub-id pub-id-type="doi">10.1007/s11103-010-9727-z</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref-35">
                <label>35</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">
						
                        <name name-style="western">
                            <surname>Joosten</surname>
                            <given-names>RP</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>te Beek</surname>
                            <given-names>TA</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Krieger</surname>
                            <given-names>E</given-names>
                        </name>
						
                        <etal/>
					</person-group>:
                    <article-title>A series of PDB related databases for everyday needs.</article-title>
                    <source>
						
                        <italic toggle="yes">Nucleic Acids Res.</italic>
					</source>
                    <year>2011</year>;<volume>39</volume>(<issue>Database issue</issue>):<fpage>D411</fpage>&#x2013;<lpage>419</lpage>.
                    <pub-id pub-id-type="pmid">21071423</pub-id>
                    <pub-id pub-id-type="doi">10.1093/nar/gkq1105</pub-id>
                    <pub-id pub-id-type="pmcid">3013697</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref-36">
                <label>36</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">
						
                        <name name-style="western">
                            <surname>Larkin</surname>
                            <given-names>MA</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Blackshields</surname>
                            <given-names>G</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Brown</surname>
                            <given-names>NP</given-names>
                        </name>
						
                        <etal/>
					</person-group>:
                    <article-title>Clustal W and Clustal X version 2.0.</article-title>
                    <source>
						
                        <italic toggle="yes">Bioinformatics.</italic>
					</source>
                    <year>2007</year>;<volume>23</volume>(<issue>21</issue>):<fpage>2947</fpage>&#x2013;<lpage>2948</lpage>.
                    <pub-id pub-id-type="pmid">17846036</pub-id>
                    <pub-id pub-id-type="doi">10.1093/bioinformatics/btm404</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref-37">
                <label>37</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">
						
                        <name name-style="western">
                            <surname>Gouy</surname>
                            <given-names>M</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Guindon</surname>
                            <given-names>S</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Gascuel</surname>
                            <given-names>O</given-names>
                        </name>
					</person-group>:
                    <article-title>SeaView version 4: A multiplatform graphical user interface for sequence alignment and phylogenetic tree building.</article-title>
                    <source>
						
                        <italic toggle="yes">Mol Biol Evol.</italic>
					</source>
                    <year>2010</year>;<volume>27</volume>(<issue>2</issue>):<fpage>221</fpage>&#x2013;<lpage>224</lpage>.
                    <pub-id pub-id-type="pmid">19854763</pub-id>
                    <pub-id pub-id-type="doi">10.1093/molbev/msp259</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref-38">
                <label>38</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">
						
                        <name name-style="western">
                            <surname>Konagurthu</surname>
                            <given-names>AS</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Whisstock</surname>
                            <given-names>JC</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Stuckey</surname>
                            <given-names>PJ</given-names>
                        </name>
						
                        <etal/>
					</person-group>:
                    <article-title>MUSTANG: a multiple structural alignment algorithm.</article-title>
                    <source>
						
                        <italic toggle="yes">Proteins.</italic>
					</source>
                    <year>2006</year>;<volume>64</volume>(<issue>3</issue>):<fpage>559</fpage>&#x2013;<lpage>574</lpage>.
                    <pub-id pub-id-type="pmid">16736488</pub-id>
                    <pub-id pub-id-type="doi">10.1002/prot.20921</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref-39">
                <label>39</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">
						
                        <name name-style="western">
                            <surname>Ionescu</surname>
                            <given-names>M</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Zaini</surname>
                            <given-names>PA</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Baccari</surname>
                            <given-names>C</given-names>
                        </name>
						
                        <etal/>
					</person-group>:
                    <article-title>
                        <italic toggle="yes">Xylella fastidiosa</italic> outer membrane vesicles modulate plant colonization by blocking attachment to surfaces.</article-title>
                    <source>
						
                        <italic toggle="yes">Proc Natl Acad Sci U S A.</italic>
					</source>
                    <year>2014</year>;<volume>111</volume>(<issue>37</issue>):<fpage>E3910</fpage>&#x2013;<lpage>E3918</lpage>.
                    <pub-id pub-id-type="pmid">25197068</pub-id>
                    <pub-id pub-id-type="doi">10.1073/pnas.1414944111</pub-id>
                    <pub-id pub-id-type="pmcid">4169949</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref-40">
                <label>40</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">
						
                        <name name-style="western">
                            <surname>Lindow</surname>
                            <given-names>S</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Olson</surname>
                            <given-names>W</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Buchner</surname>
                            <given-names>R</given-names>
                        </name>
					</person-group>:
                    <article-title>Colonization of Dormant Walnut Buds by 
                        <italic toggle="yes">Xanthomonas arboricola</italic> pv. 
                        <italic toggle="yes">juglandis</italic> Is Predictive of Subsequent Disease.</article-title>
                    <source>
						
                        <italic toggle="yes">Phytopathology.</italic>
					</source>
                    <year>2014</year>;<volume>104</volume>(<issue>11</issue>):<fpage>1163</fpage>&#x2013;<lpage>1174</lpage>.
                    <pub-id pub-id-type="pmid">25338268</pub-id>
                    <pub-id pub-id-type="doi">10.1094/PHYTO-01-14-0001-R</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref-41">
                <label>41</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">
						
                        <name name-style="western">
                            <surname>Fagen</surname>
                            <given-names>JR</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Leonard</surname>
                            <given-names>MT</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Coyle</surname>
                            <given-names>JF</given-names>
                        </name>
						
                        <etal/>
					</person-group>:
                    <article-title>
                        <italic toggle="yes">Liberibacter crescens</italic> gen. nov., sp. nov., the first cultured member of the genus 
                        <italic toggle="yes">Liberibacter</italic>.</article-title>
                    <source>
						
                        <italic toggle="yes">Int J Syst Evol Microbiol.</italic>
					</source>
                    <year>2014</year>;<volume>64</volume>(<issue>Pt 7</issue>):<fpage>2461</fpage>&#x2013;<lpage>6</lpage>.
                    <pub-id pub-id-type="pmid">24786353</pub-id>
                    <pub-id pub-id-type="doi">10.1099/ijs.0.063255-0</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref-42">
                <label>42</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">
						
                        <name name-style="western">
                            <surname>Jiang</surname>
                            <given-names>Z</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Vasil</surname>
                            <given-names>AI</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Hale</surname>
                            <given-names>JD</given-names>
                        </name>
						
                        <etal/>
					</person-group>:
                    <article-title>Effects of net charge and the number of positively charged residues on the biological activity of amphipathic alpha-helical cationic antimicrobial peptides.</article-title>
                    <source>
						
                        <italic toggle="yes">Biopolymers.</italic>
					</source>
                    <year>2008</year>;<volume>90</volume>(<issue>3</issue>):<fpage>369</fpage>&#x2013;<lpage>383</lpage>.
                    <pub-id pub-id-type="pmid">18098173</pub-id>
                    <pub-id pub-id-type="doi">10.1002/bip.20911</pub-id>
                    <pub-id pub-id-type="pmcid">2761230</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref-43">
                <label>43</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">
						
                        <name name-style="western">
                            <surname>Wang</surname>
                            <given-names>G</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Hanke</surname>
                            <given-names>ML</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Mishra</surname>
                            <given-names>B</given-names>
                        </name>
						
                        <etal/>
					</person-group>:
                    <article-title>Transformation of human cathelicidin LL-37 into selective, stable, and potent antimicrobial compounds.</article-title>
                    <source>
						
                        <italic toggle="yes">ACS Chem Biol.</italic>
					</source>
                    <year>2014</year>;<volume>9</volume>(<issue>9</issue>):<fpage>1997</fpage>&#x2013;<lpage>2002</lpage>.
                    <pub-id pub-id-type="pmid">25061850</pub-id>
                    <pub-id pub-id-type="doi">10.1021/cb500475y</pub-id>
                    <pub-id pub-id-type="pmcid">4168778</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref-44">
                <label>44</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">
						
                        <name name-style="western">
                            <surname>K&#x00f6;ksal</surname>
                            <given-names>M</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Zimmer</surname>
                            <given-names>I</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Schnitzler</surname>
                            <given-names>JP</given-names>
                        </name>
						
                        <etal/>
					</person-group>:
                    <article-title>Structure of isoprene synthase illuminates the chemical mechanism of teragram atmospheric carbon emission.</article-title>
                    <source>
						
                        <italic toggle="yes">J Mol Biol.</italic>
					</source>
                    <year>2010</year>;<volume>402</volume>(<issue>2</issue>):<fpage>363</fpage>&#x2013;<lpage>373</lpage>.
                    <pub-id pub-id-type="pmid">20624401</pub-id>
                    <pub-id pub-id-type="doi">10.1016/j.jmb.2010.07.009</pub-id>
                    <pub-id pub-id-type="pmcid">2942996</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref-45">
                <label>45</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">
						
                        <name name-style="western">
                            <surname>Shai</surname>
                            <given-names>Y</given-names>
                        </name>
					</person-group>:
                    <article-title>Mechanism of the binding, insertion and destabilization of phospholipid bilayer membranes by alpha-helical antimicrobial and cell non-selective membrane-lytic peptides.</article-title>
                    <source>
						
                        <italic toggle="yes">Biochim Biophys Acta.</italic>
					</source>
                    <year>1999</year>;<volume>1462</volume>(<issue>1&#x2013;2</issue>):<fpage>55</fpage>&#x2013;<lpage>70</lpage>.
                    <pub-id pub-id-type="pmid">10590302</pub-id>
                    <pub-id pub-id-type="doi">10.1016/S0005-2736(99)00200-X</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref-46">
                <label>46</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">
						
                        <name name-style="western">
                            <surname>Koebnik</surname>
                            <given-names>R</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Locher</surname>
                            <given-names>KP</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Van Gelder</surname>
                            <given-names>P</given-names>
                        </name>
					</person-group>:
                    <article-title>Structure and function of bacterial outer membrane proteins: barrels in a nutshell.</article-title>
                    <source>
						
                        <italic toggle="yes">Mol Microbiol.</italic>
					</source>
                    <year>2000</year>;<volume>37</volume>(<issue>2</issue>):<fpage>239</fpage>&#x2013;<lpage>253</lpage>.
                    <pub-id pub-id-type="pmid">10931321</pub-id>
                    <pub-id pub-id-type="doi">10.1046/j.1365-2958.2000.01983.x</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref-47">
                <label>47</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">
						
                        <name name-style="western">
                            <surname>Hancock</surname>
                            <given-names>RE</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Sahl</surname>
                            <given-names>HG</given-names>
                        </name>
					</person-group>:
                    <article-title>Antimicrobial and host-defense peptides as new anti-infective therapeutic strategies.</article-title>
                    <source>
						
                        <italic toggle="yes">Nat Biotechnol.</italic>
					</source>
                    <year>2006</year>;<volume>24</volume>(<issue>12</issue>):<fpage>1551</fpage>&#x2013;<lpage>1557</lpage>.
                    <pub-id pub-id-type="pmid">17160061</pub-id>
                    <pub-id pub-id-type="doi">10.1038/nbt1267</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref-48">
                <label>48</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">
						
                        <name name-style="western">
                            <surname>Gray</surname>
                            <given-names>D</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Li</surname>
                            <given-names>Z</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Hopkins</surname>
                            <given-names>D</given-names>
                        </name>
						
                        <etal/>
					</person-group>:
                    <article-title>Transgenic grapevines resistant to Pierce&#x2019;s disease.</article-title>
                    <source>
						
                        <italic toggle="yes">HortScience.</italic>
					</source>
                    <year>2005</year>;<volume>40</volume>(<issue>4</issue>):<fpage>1104</fpage>&#x2013;<lpage>1105</lpage>.
                    <ext-link ext-link-type="uri" xlink:href="http://hortsci.ashspublications.org/content/40/4/1104.4.abstract">Reference Source</ext-link>
                </mixed-citation>
            </ref>
            <ref id="ref-49">
                <label>49</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">
						
                        <name name-style="western">
                            <surname>Holm</surname>
                            <given-names>L</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>K&#x00e4;&#x00e4;ri&#x00e4;inen</surname>
                            <given-names>S</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Rosenstr&#x00f6;m</surname>
                            <given-names>P</given-names>
                        </name>
						
                        <etal/>
					</person-group>:
                    <article-title>Searching protein structure databases with DaliLite v.3.</article-title>
                    <source>
						
                        <italic toggle="yes">Bioinformatics.</italic>
					</source>
                    <year>2008</year>;<volume>24</volume>(<issue>23</issue>):<fpage>2780</fpage>&#x2013;<lpage>2781</lpage>.
                    <pub-id pub-id-type="pmid">18818215</pub-id>
                    <pub-id pub-id-type="doi">10.1093/bioinformatics/btn507</pub-id>
                    <pub-id pub-id-type="pmcid">2639270</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref-50">
                <label>50</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">
						
                        <name name-style="western">
                            <surname>Frecer</surname>
                            <given-names>V</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Ho</surname>
                            <given-names>B</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Ding</surname>
                            <given-names>JL</given-names>
                        </name>
					</person-group>:
                    <article-title>
                        <italic toggle="yes">De novo</italic> design of potent antimicrobial peptides.</article-title>
                    <source>
						
                        <italic toggle="yes">Antimicrob Agents Chemother.</italic>
					</source>
                    <year>2004</year>;<volume>48</volume>(<issue>9</issue>):<fpage>3349</fpage>&#x2013;<lpage>3357</lpage>.
                    <pub-id pub-id-type="pmid">15328096</pub-id>
                    <pub-id pub-id-type="doi">10.1128/AAC.48.9.3349-3357.2004</pub-id>
                    <pub-id pub-id-type="pmcid">514781</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref-51">
                <label>51</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">
						
                        <name name-style="western">
                            <surname>Fjell</surname>
                            <given-names>CD</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Hiss</surname>
                            <given-names>JA</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Hancock</surname>
                            <given-names>RE</given-names>
                        </name>
						
                        <etal/>
					</person-group>:
                    <article-title>Designing antimicrobial peptides: form follows function.</article-title>
                    <source>
						
                        <italic toggle="yes">Nat Rev Drug Discov.</italic>
					</source>
                    <year>2011</year>;<volume>11</volume>(<issue>1</issue>):<fpage>37</fpage>&#x2013;<lpage>51</lpage>.
                    <pub-id pub-id-type="pmid">22173434</pub-id>
                    <pub-id pub-id-type="doi">10.1038/nrd3591</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref-52">
                <label>52</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">
						
                        <name name-style="western">
                            <surname>Wang</surname>
                            <given-names>G</given-names>
                        </name>
					</person-group>:
                    <article-title>Database-Guided Discovery of Potent Peptides to Combat HIV-1 or Superbugs.</article-title>
                    <source>
						
                        <italic toggle="yes">Pharmaceuticals (Basel).</italic>
					</source>
                    <year>2013</year>;<volume>6</volume>(<issue>6</issue>):<fpage>728</fpage>&#x2013;<lpage>758</lpage>.
                    <pub-id pub-id-type="pmid">24276259</pub-id>
                    <pub-id pub-id-type="doi">10.3390/ph6060728</pub-id>
                    <pub-id pub-id-type="pmcid">3816732</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref-53">
                <label>53</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">
						
                        <name name-style="western">
                            <surname>Mader</surname>
                            <given-names>JS</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Hoskin</surname>
                            <given-names>DW</given-names>
                        </name>
					</person-group>:
                    <article-title>Cationic antimicrobial peptides as novel cytotoxic agents for cancer treatment.</article-title>
                    <source>
						
                        <italic toggle="yes">Expert Opin Investig Drugs.</italic>
					</source>
                    <year>2006</year>;<volume>15</volume>(<issue>8</issue>):<fpage>933</fpage>&#x2013;<lpage>46</lpage>.
                    <pub-id pub-id-type="pmid">16859395</pub-id>
                    <pub-id pub-id-type="doi">10.1517/13543784.15.8.933</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref-54">
                <label>54</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">
						
                        <name name-style="western">
                            <surname>Douglas</surname>
                            <given-names>S</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Hoskin</surname>
                            <given-names>DW</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Hilchie</surname>
                            <given-names>AL</given-names>
                        </name>
					</person-group>:
                    <article-title>Assessment of antimicrobial (host defense) peptides as anti-cancer agents.</article-title>
                    <source>
						
                        <italic toggle="yes">Methods Mol Biol.</italic>
					</source>
                    <year>2014</year>;<volume>1088</volume>:<fpage>159</fpage>&#x2013;<lpage>170</lpage>.
                    <pub-id pub-id-type="pmid">24146403</pub-id>
                    <pub-id pub-id-type="doi">10.1007/978-1-62703-673-3_11</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref-55">
                <label>55</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">
						
                        <name name-style="western">
                            <surname>Gaspar</surname>
                            <given-names>D</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Veiga</surname>
                            <given-names>AS</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Castanho</surname>
                            <given-names>MA</given-names>
                        </name>
					</person-group>:
                    <article-title>From antimicrobial to anticancer peptides. A review.</article-title>
                    <source>
						
                        <italic toggle="yes">Front Microbiol.</italic>
					</source>
                    <year>2013</year>;<volume>4</volume>:<fpage>294</fpage>.
                    <pub-id pub-id-type="pmid">24101917</pub-id>
                    <pub-id pub-id-type="doi">10.3389/fmicb.2013.00294</pub-id>
                    <pub-id pub-id-type="pmcid">3787199</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref-56">
                <label>56</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">
						
                        <name name-style="western">
                            <surname>He</surname>
                            <given-names>J</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Krauson</surname>
                            <given-names>AJ</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Wimley</surname>
                            <given-names>WC</given-names>
                        </name>
					</person-group>:
                    <article-title>Toward the 
                        <italic toggle="yes">de novo</italic> design of antimicrobial peptides: Lack of correlation between peptide permeabilization of lipid vesicles and antimicrobial, cytolytic, or cytotoxic activity in living cells.</article-title>
                    <source>
						
                        <italic toggle="yes">Biopolymers.</italic>
					</source>
                    <year>2014</year>;<volume>102</volume>(<issue>1</issue>):<fpage>1</fpage>&#x2013;<lpage>6</lpage>.
                    <pub-id pub-id-type="pmid">23893525</pub-id>
                    <pub-id pub-id-type="doi">10.1002/bip.22281</pub-id>
                    <pub-id pub-id-type="pmcid">3995353</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref-57">
                <label>57</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">
						
                        <name name-style="western">
                            <surname>Piana</surname>
                            <given-names>S</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Klepeis</surname>
                            <given-names>JL</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Shaw</surname>
                            <given-names>DE</given-names>
                        </name>
					</person-group>:
                    <article-title>Assessing the accuracy of physical models used in protein-folding simulations: quantitative evidence from long molecular dynamics simulations.</article-title>
                    <source>
						
                        <italic toggle="yes">Curr Opin Struct Biol.</italic>
					</source>
                    <year>2014</year>;<volume>24</volume>:<fpage>98</fpage>&#x2013;<lpage>105</lpage>.
                    <pub-id pub-id-type="pmid">24463371</pub-id>
                    <pub-id pub-id-type="doi">10.1016/j.sbi.2013.12.006</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref-58">
                <label>58</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">
						
                        <name name-style="western">
                            <surname>Mishra</surname>
                            <given-names>B</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Epand</surname>
                            <given-names>RF</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Epand</surname>
                            <given-names>RM</given-names>
                        </name>
						
                        <etal/>
					</person-group>:
                    <article-title>Structural location determines functional roles of the basic amino acids of KR-12, the smallest antimicrobial peptide from human cathelicidin LL-37.</article-title>
                    <source>
						
                        <italic toggle="yes">RSC Adv.</italic>
					</source>
                    <year>2013</year>;<volume>3</volume>(<issue>42</issue>):<fpage>19560</fpage>&#x2013;<lpage>19571</lpage>.
                    <pub-id pub-id-type="pmid">24307932</pub-id>
                    <pub-id pub-id-type="doi">10.1039/C3RA42599A</pub-id>
                    <pub-id pub-id-type="pmcid">3844289</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref-59">
                <label>59</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">
						
                        <name name-style="western">
                            <surname>Huang</surname>
                            <given-names>YB</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>He</surname>
                            <given-names>LY</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Jiang</surname>
                            <given-names>HY</given-names>
                        </name>
						
                        <etal/>
					</person-group>:
                    <article-title>Role of helicity on the anticancer mechanism of action of cationic-helical peptides.</article-title>
                    <source>
						
                        <italic toggle="yes">Int J Mol Sci.</italic>
					</source>
                    <year>2012</year>;<volume>13</volume>(<issue>6</issue>):<fpage>6849</fpage>&#x2013;<lpage>6862</lpage>.
                    <pub-id pub-id-type="pmid">22837667</pub-id>
                    <pub-id pub-id-type="doi">10.3390/ijms13066849</pub-id>
                    <pub-id pub-id-type="pmcid">3397499</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref-60">
                <label>60</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">
						
                        <name name-style="western">
                            <surname>Chapman</surname>
                            <given-names>RN</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Dimartino</surname>
                            <given-names>G</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Arora</surname>
                            <given-names>PS</given-names>
                        </name>
					</person-group>:
                    <article-title>A highly stable short alpha-helix constrained by a main-chain hydrogen-bond surrogate.</article-title>
                    <source>
						
                        <italic toggle="yes">J Am Chem Soc.</italic>
					</source>
                    <year>2004</year>;<volume>126</volume>(<issue>39</issue>):<fpage>12252</fpage>&#x2013;<lpage>12253</lpage>.
                    <pub-id pub-id-type="pmid">15453743</pub-id>
                    <pub-id pub-id-type="doi">10.1021/ja0466659</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref-61">
                <label>61</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">
						
                        <name name-style="western">
                            <surname>Bird</surname>
                            <given-names>GH</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Madani</surname>
                            <given-names>N</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Perry</surname>
                            <given-names>AF</given-names>
                        </name>
						
                        <etal/>
					</person-group>:
                    <article-title>Hydrocarbon double-stapling remedies the proteolytic instability of a lengthy peptide therapeutic.</article-title>
                    <source>
						
                        <italic toggle="yes">Proc Natl Acad Sci U S A.</italic>
					</source>
                    <year>2010</year>;<volume>107</volume>(<issue>32</issue>):<fpage>14093</fpage>&#x2013;<lpage>14098</lpage>.
                    <pub-id pub-id-type="pmid">20660316</pub-id>
                    <pub-id pub-id-type="doi">10.1073/pnas.1002713107</pub-id>
                    <pub-id pub-id-type="pmcid">2922607</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref-62">
                <label>62</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">
						
                        <name name-style="western">
                            <surname>Bird</surname>
                            <given-names>GH</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Boyapalle</surname>
                            <given-names>S</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Wong</surname>
                            <given-names>T</given-names>
                        </name>
						
                        <etal/>
					</person-group>:
                    <article-title>Mucosal delivery of a double-stapled RSV peptide prevents nasopulmonary infection.</article-title>
                    <source>
						
                        <italic toggle="yes">J Clin Invest.</italic>
					</source>
                    <year>2014</year>;<volume>124</volume>(<issue>5</issue>):<fpage>2113</fpage>&#x2013;<lpage>2124</lpage>.
                    <pub-id pub-id-type="pmid">24743147</pub-id>
                    <pub-id pub-id-type="doi">10.1172/JCI71856</pub-id>
                    <pub-id pub-id-type="pmcid">4001541</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref-63">
                <label>63</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">
						
                        <name name-style="western">
                            <surname>Harrison</surname>
                            <given-names>RS</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Shepherd</surname>
                            <given-names>NE</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Hoang</surname>
                            <given-names>HN</given-names>
                        </name>
						
                        <etal/>
					</person-group>:
                    <article-title>Downsizing human, bacterial, and viral proteins to short water-stable alpha helices that maintain biological potency.</article-title>
                    <source>
						
                        <italic toggle="yes">Proc Natl Acad Sci U S A.</italic>
					</source>
                    <year>2010</year>;<volume>107</volume>(<issue>26</issue>):<fpage>11686</fpage>&#x2013;<lpage>11691</lpage>.
                    <pub-id pub-id-type="pmid">20543141</pub-id>
                    <pub-id pub-id-type="doi">10.1073/pnas.1002498107</pub-id>
                    <pub-id pub-id-type="pmcid">2900680</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref-64">
                <label>64</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">
						
                        <name name-style="western">
                            <surname>Tyagi</surname>
                            <given-names>A</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Tuknait</surname>
                            <given-names>A</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Anand</surname>
                            <given-names>P</given-names>
                        </name>
						
                        <etal/>
					</person-group>:
                    <article-title>CancerPPD: a database of anticancer peptides and proteins.</article-title>
                    <source>
						
                        <italic toggle="yes">Nucleic Acids Res.</italic>
					</source>
                    <year>2015</year>;<volume>43</volume>(<issue>Database issue</issue>):<fpage>D837</fpage>&#x2013;<lpage>843</lpage>.
                    <pub-id pub-id-type="pmid">25270878</pub-id>
                    <pub-id pub-id-type="doi">10.1093/nar/gku892</pub-id>
                    <pub-id pub-id-type="pmcid">4384006</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref-65">
                <label>65</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">
						
                        <name name-style="western">
                            <surname>Oyston</surname>
                            <given-names>PC</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Fox</surname>
                            <given-names>MA</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Richards</surname>
                            <given-names>SJ</given-names>
                        </name>
						
                        <etal/>
					</person-group>:
                    <article-title>Novel peptide therapeutics for treatment of infections.</article-title>
                    <source>
						
                        <italic toggle="yes">J Med Microbiol.</italic>
					</source>
                    <year>2009</year>;<volume>58</volume>(<issue>Pt 8</issue>):<fpage>977</fpage>&#x2013;<lpage>987</lpage>.
                    <pub-id pub-id-type="pmid">19528155</pub-id>
                    <pub-id pub-id-type="doi">10.1099/jmm.0.011122-0</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref-66">
                <label>66</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">
						
                        <name name-style="western">
                            <surname>Peschel</surname>
                            <given-names>A</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Sahl</surname>
                            <given-names>HG</given-names>
                        </name>
					</person-group>:
                    <article-title>The co-evolution of host cationic antimicrobial peptides and microbial resistance.</article-title>
                    <source>
						
                        <italic toggle="yes">Nat Rev Microbiol.</italic>
					</source>
                    <year>2006</year>;<volume>4</volume>(<issue>7</issue>):<fpage>529</fpage>&#x2013;<lpage>536</lpage>.
                    <pub-id pub-id-type="pmid">16778838</pub-id>
                    <pub-id pub-id-type="doi">10.1038/nrmicro1441</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref-67">
                <label>67</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">
						
                        <name name-style="western">
                            <surname>Piot</surname>
                            <given-names>P</given-names>
                        </name>
					</person-group>:
                    <article-title>The 
                        <italic toggle="yes">F1000Research: Ebola</italic> article collection [v1; ref status: not peer reviewed, 
                        <ext-link ext-link-type="uri" xlink:href="http://f1000r.es/4ot">http://f1000r.es/4ot</ext-link>].</article-title>
                    <source>
					
                        <italic toggle="yes">F1000Res.</italic>
				</source>
                    <year>2014</year>;<volume>3</volume>:<fpage>269</fpage>.
                    <pub-id pub-id-type="pmid">25580233</pub-id>
                    <pub-id pub-id-type="doi">10.12688/f1000research.5685.1</pub-id>
                    <pub-id pub-id-type="pmcid">4288426</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref-68">
                <label>68</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">
						
                        <name name-style="western">
                            <surname>Piot</surname>
                            <given-names>P</given-names>
                        </name>
					</person-group>:
                    <article-title>Ebola&#x2019;s perfect storm.</article-title>
                    <source>
						
                        <italic toggle="yes">Science.</italic>
					</source>
                    <year>2014</year>;<volume>345</volume>(<issue>6202</issue>):<fpage>1221</fpage>.
                    <pub-id pub-id-type="pmid">25214580</pub-id>
                    <pub-id pub-id-type="doi">10.1126/science.1260695</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref-69">
                <label>69</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">
						
                        <name name-style="western">
                            <surname>Shoemaker</surname>
                            <given-names>CJ</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Schornberg</surname>
                            <given-names>KL</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Delos</surname>
                            <given-names>SE</given-names>
                        </name>
						
                        <etal/>
					</person-group>:
                    <article-title>Multiple cationic amphiphiles induce a Niemann-Pick C phenotype and inhibit Ebola virus entry and infection.</article-title>
                    <source>
						
                        <italic toggle="yes">PLoS One.</italic>
					</source>
                    <year>2013</year>;<volume>8</volume>(<issue>2</issue>):<fpage>e56265</fpage>.
                    <pub-id pub-id-type="pmid">23441171</pub-id>
                    <pub-id pub-id-type="doi">10.1371/journal.pone.0056265</pub-id>
                    <pub-id pub-id-type="pmcid">3575416</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref-70">
                <label>70</label>
                <mixed-citation publication-type="journal">
                    <person-group person-group-type="author">
						
                        <name name-style="western">
                            <surname>Montrose</surname>
                            <given-names>K</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Yang</surname>
                            <given-names>Y</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Sun</surname>
                            <given-names>X</given-names>
                        </name>
						
                        <etal/>
					</person-group>:
                    <article-title>Xentry, a new class of cell-penetrating peptide uniquely equipped for delivery of drugs.</article-title>
                    <source>
						
                        <italic toggle="yes">Sci Rep.</italic>
					</source>
                    <year>2013</year>;<volume>3</volume>:<fpage>1661</fpage>.
                    <pub-id pub-id-type="pmid">23588666</pub-id>
                    <pub-id pub-id-type="doi">10.1038/srep01661</pub-id>
                    <pub-id pub-id-type="pmcid">3627194</pub-id>
                </mixed-citation>
            </ref>
            <ref id="ref-71">
                <label>71</label>
                <mixed-citation publication-type="data">
                    <person-group person-group-type="author">
						
                        <name name-style="western">
                            <surname>Chakraborty</surname>
                            <given-names>S</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Phu</surname>
                            <given-names>M</given-names>
                        </name>
						
                        <name name-style="western">
                            <surname>Rao</surname>
                            <given-names>BJ</given-names>
                        </name>
						
                        <etal/>
					</person-group>:
                    <article-title>Dataset 1 in: The PDB database is a rich source of -helical anti-microbial peptides to combat disease causing pathogens.</article-title>
                    <source>
						
                        <italic toggle="yes">F1000Research.</italic>
					</source>
                    <year>2014</year>.
                    <ext-link ext-link-type="uri" xlink:href="http://dx.doi.org/10.5256/f1000research.5802.d39823">Data Source</ext-link>.</mixed-citation>
            </ref>
        </ref-list>
    </back>
    <sub-article article-type="reviewer-report" id="report11126">
        <front-stub>
            <article-id pub-id-type="doi">10.5256/f1000research.7108.r11126</article-id>
            <title-group>
                <article-title>Reviewer response for version 2</article-title>
            </title-group>
            <contrib-group>
                <contrib contrib-type="author">
                    <name>
                        <surname>Hartshorn</surname>
                        <given-names>Kevan</given-names>
                    </name>
                    <xref ref-type="aff" rid="r11126a1">1</xref>
                    <role>Referee</role>
                </contrib>
                <aff id="r11126a1">
                    <label>1</label>Department of Medicine, Boston University, Boston, MA, USA</aff>
            </contrib-group>
            <author-notes>
                <fn fn-type="conflict">
                    <p>
                        <bold>Competing interests: </bold>No competing interests were disclosed.</p>
                </fn>
            </author-notes>
            <pub-date pub-type="epub">
                <day>6</day>
                <month>11</month>
                <year>2015</year>
            </pub-date>
            <permissions>
                <copyright-statement>Copyright: &#x00a9; 2015 Hartshorn K</copyright-statement>
                <copyright-year>2015</copyright-year>
                <license xlink:href="https://creativecommons.org/licenses/by/4.0/">
                    <license-p>This is an open access peer review report distributed under the terms of the Creative Commons Attribution Licence, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.</license-p>
                </license>
            </permissions>
            <related-article ext-link-type="doi" id="relatedArticleReport11126" related-article-type="peer-reviewed-article" xlink:href="10.12688/f1000research.5802.2"/>
            <custom-meta-group>
                <custom-meta>
                    <meta-name>recommendation</meta-name>
                    <meta-value>approve</meta-value>
                </custom-meta>
            </custom-meta-group>
        </front-stub>
        <body>
            <p>I think this article is quite interesting and think the authors have answered prior critiques reasonable well. I do not have much in the way of further critiques.</p>
            <p>My specific critiques are as follows:</p>
            <p>1. The results presented in Table 3 do not show any statistics (e.g. p values or standard error).</p>
            <p>2. The best negative control for such studies is use of a scrambled version of peptide.</p>
            <p>Reviewer Expertise:</p>
            <p>NA</p>
            <p>I confirm that I have read this submission and believe that I have an appropriate level of expertise to confirm that it is of an acceptable scientific standard.</p>
        </body>
    </sub-article>
    <sub-article article-type="reviewer-report" id="report10406">
        <front-stub>
            <article-id pub-id-type="doi">10.5256/f1000research.7108.r10406</article-id>
            <title-group>
                <article-title>Reviewer response for version 2</article-title>
            </title-group>
            <contrib-group>
                <contrib contrib-type="author">
                    <name>
                        <surname>Mattoo</surname>
                        <given-names>Autar</given-names>
                    </name>
                    <xref ref-type="aff" rid="r10406a1">1</xref>
                    <role>Referee</role>
                </contrib>
                <contrib contrib-type="author">
                    <name>
                        <surname>Goyal</surname>
                        <given-names>Ravinder</given-names>
                    </name>
                    <xref ref-type="aff" rid="r10406a2">2</xref>
                    <role>Co-referee</role>
                </contrib>
                <aff id="r10406a1">
                    <label>1</label>Henry A. Wallace Beltsville Agricultural Research Center, United States Department of Agriculture, Beltsville, MD, USA</aff>
                <aff id="r10406a2">
                    <label>2</label>AAFC Lethbridge Research Center, Alberta, Canada</aff>
            </contrib-group>
            <author-notes>
                <fn fn-type="conflict">
                    <p>
                        <bold>Competing interests: </bold>No competing interests were disclosed.</p>
                </fn>
            </author-notes>
            <pub-date pub-type="epub">
                <day>19</day>
                <month>10</month>
                <year>2015</year>
            </pub-date>
            <permissions>
                <copyright-statement>Copyright: &#x00a9; 2015 Mattoo A and Goyal R</copyright-statement>
                <copyright-year>2015</copyright-year>
                <license xlink:href="https://creativecommons.org/licenses/by/4.0/">
                    <license-p>This is an open access peer review report distributed under the terms of the Creative Commons Attribution Licence, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.</license-p>
                </license>
            </permissions>
            <related-article ext-link-type="doi" id="relatedArticleReport10406" related-article-type="peer-reviewed-article" xlink:href="10.12688/f1000research.5802.2"/>
            <custom-meta-group>
                <custom-meta>
                    <meta-name>recommendation</meta-name>
                    <meta-value>approve-with-reservations</meta-value>
                </custom-meta>
            </custom-meta-group>
        </front-stub>
        <body>
            <p>
                <bold>Title:</bold>
            </p>
            <p>Suggest inserting 'sequences' after anti-microbial peptide, and include 'plant' since the search was made for plant proteins and validated on phytopathogens.</p>
            <p>
                <bold>Abstract:&#x00a0;</bold>
            </p>
            <p>The contents starting from &#x201c;Substitute therapies .... end&#x201d; &#x00a0;are hypothetical and need to be deleted or toned down.&#x00a0;</p>
            <p>
                <bold>Introduction:</bold>
            </p>
            <p>Paragraph 3. Clarify which humanitarian reasons are associated with the listed plant pathogens.&#x00a0;The central theme of the manuscript is a new search algorithm, SCALPEL and its validation. Therefore, there is a need for reasoning the development of a new algorithm in light of the existing software(s), if any. In other words, what is the necessity of a new algorithm?&#x00a0;The introduction is not crisp and balanced.&#x00a0;</p>
            <p>
                <bold>Materials and Methods:&#x00a0;</bold>
                <list list-type="bullet">
                    <list-item>
                        <p>
                            <italic>In silico:</italic> Is their a need to list all 2000 proteins in Dataset identified using search &#x2018;plants&#x2019;. Simply, it could be stated that as many plant proteins were analyzed.&#x00a0;Need more&#x00a0;details for SCALPEL vis-&#x00e1;-vis methodology.</p>
                    </list-item>
                    <list-item>
                        <p>
                            <italic>In vitro:</italic> Why&#x00a0;was&#x00a0;Kanamycin added to PD3?</p>
                    </list-item>
                </list>
                <bold>Results:</bold>
                <list list-type="order">
                    <list-item>
                        <p>Figure 1a: An explanation is required for omitting the first &#x2018;K&#x2019; in Edmundson wheel.</p>
                    </list-item>
                    <list-item>
                        <p>The main legend to Figure 1 &#x201c;Edmundson wheel for AHs in the known AMPs that were used as control&#x201d; is confusing. It does not look like the peptides corresponding to wheels c, d and e were the controls.</p>
                    </list-item>
                    <list-item>
                        <p>PPC20, 3ALGA.&#x03b1;4 and 3ALGA.&#x03b1;5 (Fig. 1c, d, e) should be described when first mentioned in the text.</p>
                    </list-item>
                    <list-item>
                        <p>Non-linear AH-AMPs consisting of two AHs: &#x201c;While the properties of the AHs in CHITI25 is reversed from that of CECB, the order in which these AHs occur is not important for functionality&#x201d; is an overstatement unless proved.</p>
                    </list-item>
                    <list-item>
                        <p>Figure 4. The PBS used for peptide dilution does not appear as a control in the Figure. The control ISS15 does not show pathogen growth inhibition at the maximum concentration tested. Thus, to conclude its MIC is &gt;300 microM is a speculation.</p>
                    </list-item>
                </list>
                <bold>Discussion:</bold>
            </p>
            <p>The discussion is entirely focused on the search software that is hardly mentioned in the Introduction, Methodology, and Results. There is more focus on the application of the current study instead of the study itself. The readership would benefit more if the discussion included scrutiny and reaffirmation of the results with relevant literature and interpretation.</p>
            <p>Reviewer Expertise:</p>
            <p>NA</p>
            <p>We confirm that we have read this submission and believe that we have an appropriate level of expertise to confirm that it is of an acceptable scientific standard, however we have significant reservations, as outlined above.</p>
        </body>
    </sub-article>
    <sub-article article-type="reviewer-report" id="report8667">
        <front-stub>
            <article-id pub-id-type="doi">10.5256/f1000research.7108.r8667</article-id>
            <title-group>
                <article-title>Reviewer response for version 2</article-title>
            </title-group>
            <contrib-group>
                <contrib contrib-type="author">
                    <name>
                        <surname>Berjeaud</surname>
                        <given-names>Jean-Marc</given-names>
                    </name>
                    <xref ref-type="aff" rid="r8667a1">1</xref>
                    <role>Referee</role>
                </contrib>
                <aff id="r8667a1">
                    <label>1</label>Laboratory of Ecological and Biological Interactions, University of Poitiers, Poitiers, France</aff>
            </contrib-group>
            <author-notes>
                <fn fn-type="conflict">
                    <p>
                        <bold>Competing interests: </bold>No competing interests were disclosed.</p>
                </fn>
            </author-notes>
            <pub-date pub-type="epub">
                <day>17</day>
                <month>6</month>
                <year>2015</year>
            </pub-date>
            <permissions>
                <copyright-statement>Copyright: &#x00a9; 2015 Berjeaud JM</copyright-statement>
                <copyright-year>2015</copyright-year>
                <license xlink:href="https://creativecommons.org/licenses/by/4.0/">
                    <license-p>This is an open access peer review report distributed under the terms of the Creative Commons Attribution Licence, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.</license-p>
                </license>
            </permissions>
            <related-article ext-link-type="doi" id="relatedArticleReport8667" related-article-type="peer-reviewed-article" xlink:href="10.12688/f1000research.5802.2"/>
            <custom-meta-group>
                <custom-meta>
                    <meta-name>recommendation</meta-name>
                    <meta-value>approve</meta-value>
                </custom-meta>
            </custom-meta-group>
        </front-stub>
        <body>
            <p>The corrections made in the new version are in agreement with my requests.&#x00a0;As a consequence I approve the indexing of this article.</p>
            <p>Reviewer Expertise:</p>
            <p>NA</p>
            <p>I confirm that I have read this submission and believe that I have an appropriate level of expertise to confirm that it is of an acceptable scientific standard.</p>
        </body>
    </sub-article>
    <sub-article article-type="reviewer-report" id="report8820">
        <front-stub>
            <article-id pub-id-type="doi">10.5256/f1000research.6202.r8820</article-id>
            <title-group>
                <article-title>Reviewer response for version 1</article-title>
            </title-group>
            <contrib-group>
                <contrib contrib-type="author">
                    <name>
                        <surname>Berjeaud</surname>
                        <given-names>Jean-Marc</given-names>
                    </name>
                    <xref ref-type="aff" rid="r8820a1">1</xref>
                    <role>Referee</role>
                </contrib>
                <aff id="r8820a1">
                    <label>1</label>Laboratory of Ecological and Biological Interactions, University of Poitiers, Poitiers, France</aff>
            </contrib-group>
            <author-notes>
                <fn fn-type="conflict">
                    <p>
                        <bold>Competing interests: </bold>No competing interests were disclosed.</p>
                </fn>
            </author-notes>
            <pub-date pub-type="epub">
                <day>1</day>
                <month>6</month>
                <year>2015</year>
            </pub-date>
            <permissions>
                <copyright-statement>Copyright: &#x00a9; 2015 Berjeaud JM</copyright-statement>
                <copyright-year>2015</copyright-year>
                <license xlink:href="https://creativecommons.org/licenses/by/4.0/">
                    <license-p>This is an open access peer review report distributed under the terms of the Creative Commons Attribution Licence, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.</license-p>
                </license>
            </permissions>
            <related-article ext-link-type="doi" id="relatedArticleReport8820" related-article-type="peer-reviewed-article" xlink:href="10.12688/f1000research.5802.1"/>
            <custom-meta-group>
                <custom-meta>
                    <meta-name>recommendation</meta-name>
                    <meta-value>approve</meta-value>
                </custom-meta>
            </custom-meta-group>
        </front-stub>
        <body>
            <p>
                <bold>
                    <italic>Title and Abstract</italic>
                </bold>:</p>
            <p>The Title of the article, "The PDB database is a rich source of alpha-helical anti-microbial peptides to combat disease causing pathogens", is appropriate for the content of the article. However because the detected peptides were solely tested toward plant pathogens the term of "plant" in the title could be considered. The abstract represent rather well the work presented in the article except the two last sentences which are expectations of the authors but were not studied in this work. Particularly the sentence : "The use of native&#x2026;" assert that peptide structure extracted from native proteins will be without adverse effect to the host but it has to be proved in my opinion.</p>
            <p>
                <bold>
                    <italic>Article content</italic>
                </bold>:</p>
            <p>The paper describes the use of a software and an
                <italic> in silico </italic>method developed by the authors to screen the protein database (PDB) to find new antimicrobial peptides on the basis of the secondary structures of these peptides. The method is innovative and very interesting. Moreover the authors proved the efficacy of their method as they synthesized peptides from portions of protein sequences presenting secondary structures resembling cecropin B and demonstrated the antimicrobial activity of these new peptides.</p>
            <p>However I did not understand why they used an anionic peptide as the negative control. Indeed it is well known that the global positive charge of the peptides is required for their initial stacking on the membrane of target cells. Thus it is predictable that any anionic peptide will be inactive.</p>
            <p>
                <bold>
                    <italic>Conclusions</italic>
                </bold>:</p>
            <p>The main problem concerns the conclusions of the article. Indeed there are not sufficient experimental evidences in the article to assert that the alpha-helical peptides with antimicrobial activity have a strong potency to act toward cancer cells. In my experience I tested several alpha-helical peptides which were solely antimicrobial. Thus I strongly suggest to moderate this conclusions part of the manuscript.</p>
            <p>Reviewer Expertise:</p>
            <p>NA</p>
            <p>I confirm that I have read this submission and believe that I have an appropriate level of expertise to confirm that it is of an acceptable scientific standard.</p>
        </body>
        <sub-article article-type="response" id="comment1412-8820">
            <front-stub>
                <contrib-group>
                    <contrib contrib-type="author">
                        <name>
                            <surname>Chakraborty</surname>
                            <given-names>Sandeep</given-names>
                        </name>
                        <aff>Tata Institute of Fundamental Research, India</aff>
                    </contrib>
                </contrib-group>
                <author-notes>
                    <fn fn-type="conflict">
                        <p>
                            <bold>Competing interests: </bold>No competing interests were disclosed.</p>
                    </fn>
                </author-notes>
                <pub-date pub-type="epub">
                    <day>4</day>
                    <month>6</month>
                    <year>2015</year>
                </pub-date>
            </front-stub>
            <body>
                <p>Dear Dr Berjeaud,</p>
                <p>We would like to thank you for taking the time to review this paper. Please find our responses below.</p>
                <p>
                    <bold>Title and Abstract: The Title of the article, &#x201d;The PDB database is a rich source of alpha-helical anti-microbial peptides to combat disease causing pathogens&#x201d;, is appropriate for the content of the article. However because the detected peptides were solely tested toward plant pathogens the term of &#x201d;plant&#x201d; in the title could be considered.</bold>
                </p>
                <p>We are in the process of testing these peptides on other pathogens. Furthermore, considering that the mechanism of the inhibitory effect of these peptides is independent of the pathogen host, we are quite confident of replicating our results on other &#x2018;non-plant&#x2019; pathogens.</p>
                <p>
                    <bold>The abstract represent rather well the work presented in the article except the two last sentences which are expectations of the authors but were not studied in this work. Particularly the sentence : &#x201d;The use of native&#x201d; assert that peptide structure extracted from native proteins will be without adverse effect to the host but it has to be proved in my opinion.</bold>
                </p>
                <p>We believe this is an important hypothesis, although unproven, which differentiates SCALPEL from other methods of identifying anti-microbial peptides. However, we have modified the statement in the abstract to make this less of an assertion, and more of a hypothesis.</p>
                <p>
                    <bold>Article content: The paper describes the use of a software and an in silico method developed by the authors to screen the protein database (PDB) to find new antimicrobial peptides on the basis of the secondary structures of these peptides. The method is innovative and very interesting. Moreover the authors proved the efficacy of their method as they synthesized peptides from portions of protein sequences presenting secondary structures resembling cecropin B and demonstrated the antimicrobial activity of these new peptides.</bold>
                </p>
                <p>We appreciate the positive comments.</p>
                <p>
                    <bold>However I did not understand why they used an anionic peptide as the negative control. Indeed it is well known that the global positive charge of the peptides is required for their initial stacking on the membrane of target cells. Thus it is predictable that any anionic peptide will be inactive.</bold>
                </p>
                <p>We have used this as a negative control. If our experimental setup in the process of adding the peptides had any undesired conditions which was inhibiting the pathogens, this anionic peptide would show positive results. So, this is slightly different from a null negative control, as it involves adding a peptide.</p>
                <p>
                    <bold>Conclusions: The main problem concerns the conclusions of the article. Indeed there are not sufficient experimental evidences in the article to assert that the alpha-helical peptides with antimicrobial activity have a strong potency to act toward cancer cells. In my experience I tested several alpha-helical peptides which were solely antimicrobial. Thus I strongly suggest to moderate this conclusions part of the manuscript.</bold>
                </p>
                <p>We appreciate your concern regarding the lack of confirmatory evidence of AH peptides as anti-cancer therapeutics. However, this continues to be an active front in research, and we hope that SCALPEL will provide further avenues for testing this hypothesis. We have cited two recent papers- 
                    <ext-link ext-link-type="uri" xlink:href="http://www.ncbi.nlm.nih.gov/pubmed/25270878">http://www.ncbi.nlm.nih.gov/pubmed/25270878</ext-link> and 
                    <ext-link ext-link-type="uri" xlink:href="http://www.ncbi.nlm.nih.gov/pubmed/24101917">http://www.ncbi.nlm.nih.gov/pubmed/24101917</ext-link>
                </p>
                <p>in this context. Also, we have modified the text to reflect the lack of conclusiveness in such studies.Once again, we are thankful for your insightful comments, and hope to have addressed your concerns.</p>
                <p>Thanking you,</p>
                <p>Sincerely,</p>
                <p>Sandeep Chakraborty</p>
                <p>Plant Sciences Department,</p>
                <p>University of California, Davis, CA 95616, USA.</p>
            </body>
        </sub-article>
    </sub-article>
</article>
