ALL Metrics
-
Views
-
Downloads
Get PDF
Get XML
Cite
Export
Track
Research Article

The stretcher spontaneous neurodegenerative mutation models Charcot-Marie-Tooth disease type 4D

[version 1; peer review: 3 approved]
PUBLISHED 13 Feb 2013
Author details Author details
OPEN PEER REVIEW
REVIEWER STATUS

This article is included in the Rare diseases collection.

Abstract

Mice affected by a spontaneous mutation which arose within our colony exhibited a neuromuscular phenotype involving tremor and characteristic stretching of the rear limbs. The mutant, named stretcher, was used to breed a backcross cohort for genetic mapping studies. The gene responsible for the mutant phenotype was mapped to a small region on mouse chromosome 15, with a LOD score above 20. Candidate genes within the region included the Ndrg1 gene. Examination of this gene in the mutant mouse strain revealed that exons 10 to 14 had been deleted. Mutations in the human orthologue are known to result in Charcot-Marie-Tooth disease type 4D (CMT4D) a severe early-onset disorder involving Schwann cell dysfunction and extensive demyelination. The stretcher mutant mouse is more severely affected than mice in which the Ndrg1 gene had been knocked out by homologous recombination. Our results demonstrate that the Ndrg1str mutation provides a new model for CMT4D, and demonstrate that exons 10 to 14 of Ndrg1 encode amino acids crucial to the appropriate function of Ndrg1 in the central nervous system.

Introduction

Over 60 spontaneous mouse mutations that exhibit neurological disorders including movement abnormalities or epilepsy conditions are listed in the Mouse Genome Informatics database. Most of these mutations have been defined at the molecular level. Identifying the genes affected has provided insights into the molecular basis of neurological functions; some examples are reviewed in1,2. The availability of animal models of disease aids in understanding its molecular basis and is valuable in the search for new treatments. Nevertheless, many neurological diseases of humans still lack satisfactory animal models.

Previously we had mapped a locus, Idd11, which conferred susceptibility to type 1 diabetes in the NOD/LtJ mouse strain3. During the production of congenic mice bearing the C57BL/6J (B6) resistance allele of Idd113,4 on the NOD background in our laboratory, a spontaneous mutation arose. These mutant mice exhibited a neurological defect. This paper describes the phenotypic characterization of these mutant mice, as well as mapping, identification and characterization of the mutant gene.

Materials and methods

Mice

Mouse work was performed with ethics approval from the Royal Melbourne Hospital Animal Ethics Committee and from the Animal Ethics Committee of The University of Western Australia. All procedures conformed to the Guidelines for the Care and Use of Experimental Animals described by the National Health and Medical Research Council of Australia. BALB/c, C57BL/6J (B6), DBA/2 and NOD/LtJ (NOD) mice were obtained from either the specific-pathogen free colonies of The Walter and Eliza Hall Institute of Medical Research or from the Animal Resources Centre (Murdoch, Western Australia). NOD.Slc9a1b congenic mice4 were maintained in conventional M1 "shoe box" mouse cage (335mm Long × 160mm Wide × 130mm High).

Each cage comprised of 1 male and 1 female with litters being weaned from the box at 3 weeks of age. All animals were provided with food and water ad libitum, aspen wood bedding and an environment enrichment consisting of tissue paper for nesting. All animals were cared for by specialist trained staff with experience in clinical observations of ill health, and behaviour irregularities. A vet was on site to provide an opinion to any observations and instigate necropsy if required. Animals that exhibited ill health were euthanased in pre-charged carbon dioxide chambers. The mice displaying the neurological defect, named stretcher (str), were intercrossed with BALB/c mice obtained from The Walter and Eliza Hall Institute of Medical Research. A congenic strain, BALB/c.str was developed after 10 generations of backcrossing to BALB/c, selecting for retention of NOD-derived alleles at markers on chromosome 15. To map the str mutation, we chose to mate NOD.Slc9a1b mutant mice to a third strain, DBA/2 (D2). This was done because the NOD.Slc9a1b mice already had an introduced B6 chromosome region which could potentially complicate mapping.

Genotyping and gene mapping

Conventional microsatellite genotyping was performed using MIT markers5 under standard conditions as previously described3. Novel markers were also developed as follows and are listed in Table 1. cDNA sequences of genes previously mapped to the region were BLASTed against GENBANK DNA databases to retrieve genomic sequences. Genomic sequences were also retrieved from the mouse genome sequence6 as reported in the NCBI 37 July 2007 assembly (UCSC Genome Browser). Simple sequence length repeats were selected and primers were designed using the Primer3 program7. Primer sequences are listed in Table 1. These were used to amplify the relevant alleles from NOD and DBA/2 DNA. LOD scores and significance thresholds were calculated as described by Lander and Kruglyak (1995)8.

Table 1. Primers used to amplify novel markers.

Simple sequence length repeats were found from inspection of relevant genomic sequences. The location of the nearest known gene, the genomic position (in Mb from the UCSC July 2007 freeze) of the repeat; the primers used to amplify it; the annealing temperature used (Tm), and the sizes of alleles from B6, DBA/2 and NOD mice, are indicated.

MarkerGeneMbLeft primer (5´-3´)Right primer (5´-3´)TmB6DBA/2NOD
D15Mor1 Kcnq3 66.1ATGTGTGCTGCTTTGAGCTGTGCTATGTATCCACACAGCAAA60235235180
D15Mor2 Tgn 66.5CTGCCATGGCTTCATTTTCTGCAAATGCCAGGGTTCTGTA60230220230
D15Mor3 B8C052212 66.6CCATACCCCAGAAAGAAAAGTCCTTTAACATGATGGGAGA56128128128
D15Mor4 Ndrg1 66.8AGGTCAGACAGGGTCAGCTAAGCACATCCTCTCCCACTGAGG60155155150
D15Mor5 Siat4 66.9ATGTCTGCTGAGTGCTGAGGGATGCCACCCTCCTACACAT59194194235
D15Mor6 Etoile 68.5CCAGGATTTCTTTGGTCTTCTTTCATGTACCAGGTGCCATGAA60193193188

RNA isolation, cDNA synthesis and sequencing

Whole kidneys from wild-type BALB/c mice or mutant mice euthanised by exposure to carbon dioxide gas were homogenised in 500µl of Triazol (Gibco) reagent and RNA was extracted according to the manufacturer’s instructions. For cDNA synthesis, 2µg of RNA was reverse transcribed using 1 × reverse transcription buffer (Promega), 1U of RNase inhibitor (Invitrogen), 2mM of dNTPs, 50ng/µl of random hexamers (Promega), and 8U of MMLV-reverse transciptase (Promega) in a total volume of 20µl. Reaction mixes were incubated at 42°C for 60 minutes and the reaction stopped by heat inactivation at 95°C for 10 minutes. The cDNA was used as a template for the amplification of a PCR product spanning exon 6 to 15 of the Ndrg1 gene. The reaction consisted of 1x PCR buffer, 2.5mM MgCl2, 5mM dNTPs, 1.5U Taq polymerase (Kappa), 20ng of each primer (5' GAGGACATGCAGGAGATCAC 3' and 5' CAGAGGCTGTGCGGGACC 3') and water in a total volume of 50µl. PCR cycling conditions consisted of initial denaturation at 95°C followed by 40 cycles of denaturation at 95°C for 30 seconds, annealing at 55°C for 30 seconds and extension at 72°C for 45 seconds with a final extension step at 72°C for 7 minutes. The products were cleaned with PCR purification columns (Qiagen) and sequenced using BigDye Terminator chemistry (Life Technologies).

Northern blotting

For northern blotting, 5µg of RNA was electrophoresed on a 1.2% agarose/formamide gel for 2 hours in MOPS buffer. The RNA was transferred to a nitrocellulose membrane via capillary-wick blotting in SSC buffer (Sigma-Aldrich) for 3 hours and the membrane was dried in an oven set at 80ºC for ten minutes. The RNA was fixed onto the membrane by a 4 minute exposure to UV light (312nm) in a UV cabinet. A DNA probe was constructed from a 233bp PCR product spanning exons 2 to 4 of Ndrg1 amplified from mouse kidney cDNA using primers 5' GACCTCGCTGAGGTGAAGCC 3' and 5' GTGATCTCCTGCATGTCCTC 3'. The PCR product was labelled with 32P-CTP using a Random Primed Labelling kit (Roche) according to the manufacturer’s instructions. The membrane was incubated in 3ml of Ultrahyb® hybridization solution (Ambion) for 30 minutes at 42ºC and replaced with 5ml of fresh solution containing the denatured labelled probe (activity of 6.0 × 105 cpm/ml). Hybridization was carried out with rotation at 42ºC for 24 hours. The membrane was then washed twice in 2x SCC, 0.1% SDS buffer pre-warmed to 42ºC for 10 minutes and twice with 0.1xSCC, 0.1% SDS buffer for 15 minutes. The membrane was wrapped in cling film and exposed to Medical X-Ray film for 16 hours at –80ºC. The film was developed on an AGFA CP100 processor.

Western blotting

For isolation of total protein, sciatic nerves were dissected and homogenised in RIPA buffer (1% Nonidet P-40, 0.1%SDS, 0.5% deoxycholate (Sigma-Aldrich), 150mM NaCl, 50mM Tris pH 8.0, 10µg/ml aprotinin, 1mM PMSF, 1mM benzamidine (Sigma-Aldrich), 0.1mM Na3VO4) and centrifuged at 13,000rpm for 20 minutes at 4ºC. The supernatant was transferred to a new tube and quantitated. 10µg of protein was loaded into single wells of a 12% SDS-PAGE stacking gel (Invitrogen) and electrophoresed at 125V for 30 minutes, and 200V for approximately 1 hr. Proteins were transferred to PVDF membranes (Invitrogen) by western blotting at 30V overnight at 4°C. The membranes were probed first with an affinity-purified polyclonal rabbit antibody raised against the full-length NDRG1 protein (A gift from K. Kokame and T. Miyata). After exposure and subsequent stripping, the membrane was then re-probed with a goat polyclonal IgG directed against the N-terminus of the human NDRG1 protein (Santa Cruz Biotech). Immuno-labelled protein bands were visualised using the ECL+ Chemiluminescence kit (Amersham Biosciences) and exposure to Hyperfilm™ ECL Chemiluminescence film (Amersham Biosciences).

DNA sequencing

Primers were derived from the Ndrg1 genomic sequence and used to amplify DNA from B6, NOD/LtJ, and BALB/c.str mice. Sequencing was performed using the Big Dye terminator kit (Life Technologies) followed by capillary electrophoresis on a 3730 DNA analyser (Life Technologies).

Bioinformatics and model construction

Hypothetical protein models were constructed from the Ndrg1str cDNA sequence using The HMMSTR/Rosetta Server (available at http://www.bioinfo.rpi.edu/bystrc/hmmstr/server.php) This software implements the HMMSTR (a hidden Markov model for local and secondary structure prediction) and Rosetta (a Monte Carlo Fragment Insertion protein folding program) programs to predict the structure of proteins9. Wild-type and mutant protein sequences were analysed at http://www.predictprotein.org/ to determine whether esterase classification was retained.

Results

Phenotype of the mutant stretcher mice

The spontaneous mutation was observed in our NOD.Slc9a1b congenic mouse strain4 (referred to as NOD.Idd11B in that paper). The mice showed a characteristic stretching of the rear limbs, especially when they were handled for examination (Figure 1). This feature inspired the mutant strain to be named stretcher (str). The characteristic stretching was accompanied by tremor. Mice also clasped their hind limbs when suspended. The phenotype was most noticeable after 5 weeks of age and progressively worsened, so that after 15 weeks the mice became weak and showed severe tremor of the hind limbs.

b8590330-4a8b-45f2-acec-9ca660cb90ef_figure1.gif

Figure 1. Stretcher mutant mouse phenotype.

The stretcher mutant is characterized by the stretching and “freezing” of the hind limbs, as illustrated in this photograph. The trait is most apparent when the mice are challenged with some behavioural intervention (e.g. handling for clinical examination).

Because the strain in which the mutation arose develops type 1 diabetes4, there was a danger of losing the mutant stocks, so we introgressed the str mutation onto the nondiabetic strain, BALB/c. In general, though they are fertile, the male str mice have difficulty in mating. Therefore, the BALB/c.str strain was derived by 10 generations of backcrossing females to BALB/c males (selecting for linked markers that were developed as described below). This strain was maintained by sib mating, taking care to set up brother-sister pairs as soon as they reached breeding age.

Mapping of the str gene

At the same time as the congenic mice were being produced, affected NOD.Slc9a1b mice were also mated with DBA/2 mice in order to map the str locus. The F1 offspring were unaffected, so F2 progeny were produced and observed for the stretcher phenotype. DNA samples from 58 affected F2 mice and 269 unaffected mice were genotyped with markers distributed across the genome. Linkage was observed to markers only on chromosome 15 (Figure 2) with a single-point LOD score = 23.9 at D15Mit63. High resolution genotyping was then performed on both affected and unaffected F2 mice. In this way, it was possible to map the str locus to an interval of approximately 2cM between the markers D15Mit233 and D15Mit144 (Figure 3B). We developed simple sequence length repeat polymorphic markers associated with a number of genes that mapped to the general area, including Kcnq3, Siat4a and Etoile (Table 1). By testing these markers on the panel of F2 mice carrying recombinations between the flanking markers, we excluded Kcnq3 and Etoile as candidates for str, since these mapped either centromeric or telomeric of the critical region, respectively. The D15Mor1 marker defined the new centromeric boundary of the region in which the str locus was mapped. The markers D15Mor3 and –4, defining the Wisp and Siat4a genes respectively, were located within this interval.

b8590330-4a8b-45f2-acec-9ca660cb90ef_figure2.gif

Figure 2. Genome scan to map the str mutation.

Affected F2 progeny (n=49) of (NOD.str x DBA/2) F1 parents were typed with microsatellite markers with an average spacing of 20cM over the 19 autosomes. LOD scores were calculated and the dashed line shows the threshold for significance for an F2 genome-wide scan (Lander & Kruglyak, 1995)8.

b8590330-4a8b-45f2-acec-9ca660cb90ef_figure3.gif

Figure 3. Fine mapping of str mutation.

A. Affected F2 mice were typed with markers on chromosome 15 and LOD scores calculated as in Figure 1. B. Affected and unaffected mice which had recombinations within 5 cM of the peak of linkage were genotyped with additional markers. “Mit” denotes D15Mit markers, with their given positions in cM; “Mor” denotes novel D15Mor markers developed here (see also Table 1). Filled squares = homozygous for allele derived from the NOD.str strain; d = at least one copy of DBA/2 allele. C. Genomic map of chromosome 15 between the flanking markers D15Mor1 (which is in an intron of Kcnq3) and D15Mit212, from 66.1Mb to 68.5 Mb of the UCSC October 2007 Assembly.

Sequencing the Ndrg1 gene from str mice

Although the critical region covers 3Mb, this interval is relatively gene-poor with only 11 known gene transcripts (Figure 3C). However, several of these genes could be considered candidates for the str mutation. Of these, Ndrg1 was considered as an especially good candidate since mutations in the human orthologue have been shown to be the cause of a demyelinating peripheral neuropathy, Charcot-Marie-Tooth disease type 4D10. This disorder is characterized clinically by distal muscle wasting and atrophy, tendon areflexia, and sensory loss, with onset before ten years of age. Therefore, DNA from str and wild-type NOD mice was amplified using primers designed to amplify Ndrg1 exons from the genomic sequence.

Sequences of these amplicons were compared to the available genomic sequences but no polymorphisms which would result in amino acid substitutions were identified. During the course of this work, we were unable to amplify exons 10, 11, 12, 13 or 14 from the str mice. We reasoned the most likely explanation for this finding was that these exons had been deleted. A number of primers flanking exons 9 and 15 were designed and used in various combinations to test this hypothesis. Eventually, we were able to confirm that these exons had in fact been deleted, and to define the exact points between which the deletion had occurred. As shown in Figure 4, over 5kb of DNA encompassing exons 10 to 14 had been deleted. The deletion breakpoints are precise, with no addition of nontemplated nucleotides.

b8590330-4a8b-45f2-acec-9ca660cb90ef_figure4.gif

Figure 4. Sequence of Ndrg1 allele from stretcher mice.

A. Genomic organization of Ndrg1 gene. Exons are represented by filled boxes. The extent of deletion between introns 9 and 14 is indicated; the deleted sequence is indicated by the dotted line and empty boxes. Sequence is shown reversed in comparison to chromosomal orientation. B. Sequence flanking the deletion point. Lower case: sequence from intron 9; upper case: intron 14 sequence; underline: sites for primers to amplify deletion allele.

Expression of mutant Ndrg1 transcripts and protein

The northern blot analysis revealed a shorter mRNA band, present in the str animals at levels similar to the normal product found in WT littermates (Figure 5A). The sequence of Ndrg1str cDNA confirmed that transcripts from the mutant allele were processed with in-frame splicing directly from exons 9 to 15 (Figure 5C). A western blot analysis of protein extracted from sciatic nerve revealed a faint band at ~32 kDa, corresponding to the expected molecular mass of the mutant protein missing the 99 amino acids encoded by the deleted exons (Figure 5B). Bioinformatic analysis of the abnormal protein showed it could remain classified as a member of the esterases/lipases superfamily. The one letter amino acid codes for both the ndrg1 WT and mutant proteins are displayed below:

Ndrg1 WT

msrelhdvdlaevkplvekgesitgllqefdvqeqdietlhgslhvtlcgtpkgnrpviltyhdigmnhktcynplfnsedmqeitqhfavchvdapgqqdgapsfpvgymypsmdqlaemlpgvlhqfglksvigmgtgagayiltrfalnnpemveglvlmnvnpcaegwmdwaaskisgwtqalpdmvvshlfgkeeihnnvevvhtyrqhilndmnpsnlhlfisaynsrrdleierpmpgthtvtlqcpallvvgdnspavdavvecnskldptkttllkmadcgglpqisqpaklaeafkyfvqgmgympsasmtrlmrsrtasgssvtslegtrsrshtsegprsrshtsegsrsrshtsedarlnitpnsgatgnnagpksmevsc.

Ndrg1 mutant

msrelhdvdlaevkplvekgesitgllqefdvqeqdietlhgslhvtlcgtpkgnrpviltyhdigmnhktcynplfnsedmqeitqhfavchvdapgqqdgapsfpvgymypsmdqlaemlpgvlhqfglksvigmgtgagayiltrfalnnpemveglvlmnvnpcaegwmdwaaskisgwtqalpdmvvshlfgkpaklaeafkyfvqgmgympsasmtrlmrsrtasgssvtslegtrsrshtsegprsrshtsegsrsrshtsedarlnitpnsgatgnnagpksmevsc.

b8590330-4a8b-45f2-acec-9ca660cb90ef_figure5.gif

Figure 5. Analysis of Ndrg1str transcripts and protein product.

A. A northern blot of RNA from kidneys of wild-type and str mice. A 233bp probe spanning exons 2–4 detected in the mutant mouse anRNA species shorter than that seen in the wild-type Ndrg1 RNA (left panel). Ethidium bromide-staining of the agarose gel prior to northern transfer showed equal amounts of RNA were loaded (right panel). B. Western blot of sciatic nerve lysates prepared from wild-type and str mutant mice, probed with antibodies raised against the full-length Ndrg1 protein (left) or GAPDH (right). The full length (43 kDa) Ndrg1 protein was absent from the lysate of the str mice but an immunoreactive truncated (32 kDa) protein was present in a lower amount; this size is approximately that predicted for the Ndrg1str mutant protein. C. Chromatograms and translated protein sequences of Ndrg1 cDNA prepared from kidney tissue from 1) wildtype BALB/C and 2) the mutant mouse. The deletion results in the skipping of exons 10–14. Exon 15 is spliced in-frame with exon 9.

Further biochemical and structural characterization of the effect of the stretcher mutation is described elsewhere11.

Hypothetical model of truncated Ndrg1

Splice sites for exons 9 and 15 were unaffected by the deletion, and sequencing of the transcripts from the truncated gene showed they could be spliced correctly but would encode a smaller protein product than would the wild-type gene. Hypothetical structures for the normal and mutant proteins were generated using the HMMSTR/Rosetta Server9. These models are presented in Figure 6. The predicted structure of the truncated protein has an overall similarity to the wild-type, but also contains conformational changes in compensation for the deleted sequences. The major changes to the first third of the molecule may explain the functional deficit of the mutant Ndrg1 molecule in the str mice. In view of the low amounts detectable by western blot, the mutant protein is likely to be unstable.

b8590330-4a8b-45f2-acec-9ca660cb90ef_figure6.gif

Figure 6. Hypothetical structure of wild-type Ndrg1 (upper) and the Ndrg1str mutant (lower) proteins.

Certain residues are indicated for reference. Cyan, amino acids prior to #199; red, residues encoded by exons deleted in the Ndrg1str mutant; blue, residues 298-end of wild-type Ndrg1.

Discussion

Here we report the identification and characterization of the spontaneous mutant stretcher mouse, a new model of Charcot-Marie-Tooth 4D disease, with a spontaneous deletion of exons 10–14 of the Ndrg1 gene. We showed that the Ndrg1str mutation results in low levels of expression of a truncated protein which, compared to the normal protein, is missing 99 amino acids (ie #199 to 297 of the wild-type sequence).

The absent Ndrg1 fragment is due to the deletion in the Ndrg1str allele. The protein fragment encoded by the deleted exons does not show homology to any particular conserved domain family. The functional importance of the missing domain is highlighted by both the str mutation and the human splicing mutation, 2290787G>A which skipped exon 912. The reading frame was preserved in both mutations, yet the phenotype in each case was severe peripheral neuropathy. The low detectable levels of aberrant protein suggest that it is unstable, leading to the neurological phenotype observed only in homozygote mutant mice.

The stretcher mutation has been characterized by histology11 and is more severely affected in both molecular and behavioural phenotypes than was reported for the Ndrg1-/- mouse13. Though the comparisons should be made on the same genetic background, the milder phenotype of the Ndrg1-/- mouse is probably due to the knockout strategy which resulted in excision of the promoter and exon 1, but left intact the initiation codon in exon 2 as well as the rest of the coding region. It seems that these mice are able to produce sufficient amounts of full-length protein to avoid the more extreme phenotype displayed by the stretcher mutant mice, and only display the reported milder phenotype of muscle weakness.

We conclude the Ndrg1str mutant mouse will be a useful resource for investigating the role of Ndrg1 in maintaining the myelin sheath, and for modelling the human disorder, Charcot-Marie-Tooth disease 4D.

Comments on this article Comments (0)

Version 1
VERSION 1 PUBLISHED 13 Feb 2013
Comment
Author details Author details
Competing interests
Grant information
Copyright
Download
 
Export To
metrics
Views Downloads
F1000Research - -
PubMed Central
Data from PMC are received and updated monthly.
- -
Citations
CITE
how to cite this article
Chandler D, Lopaticki S, Huang D et al. The stretcher spontaneous neurodegenerative mutation models Charcot-Marie-Tooth disease type 4D [version 1; peer review: 3 approved]. F1000Research 2013, 2:46 (https://doi.org/10.12688/f1000research.2-46.v1)
NOTE: If applicable, it is important to ensure the information in square brackets after the title is included in all citations of this article.
track
receive updates on this article
Track an article to receive email alerts on any updates to this article.

Open Peer Review

Current Reviewer Status: ?
Key to Reviewer Statuses VIEW
ApprovedThe paper is scientifically sound in its current form and only minor, if any, improvements are suggested
Approved with reservations A number of small changes, sometimes more significant revisions are required to address specific details and improve the papers academic merit.
Not approvedFundamental flaws in the paper seriously undermine the findings and conclusions
Version 1
VERSION 1
PUBLISHED 13 Feb 2013
Views
11
Cite
Reviewer Report 20 May 2013
Angelo Schenone, Department of Neurology, University of Genoa, Liguria, Italy 
Approved
VIEWS 11
The title and abstract are appropriate for the content of the article and the abstract does represent a good summary of the work. Design, methods and analysis are nicely explained and indeed appropriate for the topic of the study. Results ... Continue reading
CITE
CITE
HOW TO CITE THIS REPORT
Schenone A. Reviewer Report For: The stretcher spontaneous neurodegenerative mutation models Charcot-Marie-Tooth disease type 4D [version 1; peer review: 3 approved]. F1000Research 2013, 2:46 (https://doi.org/10.5256/f1000research.300.r959)
NOTE: it is important to ensure the information in square brackets after the title is included in all citations of this article.
Views
10
Cite
Reviewer Report 07 May 2013
Fransesc Palau, Rare and Genetic Diseases Program, Centro de Investigación Príncipe Felipe (CIPF), Valencia, Spain 
Approved
VIEWS 10
This paper provides new knowledge on the role of the Ndrg1 gene in the biology of peripheral nerve, and more specifically in the pathophysiology of Charcot-Marie-Tooth disease type 4D (CMT4D) caused by mutations in Ndrg1. Most importantly, the stretcher mouse (Ndrg1str) ... Continue reading
CITE
CITE
HOW TO CITE THIS REPORT
Palau F. Reviewer Report For: The stretcher spontaneous neurodegenerative mutation models Charcot-Marie-Tooth disease type 4D [version 1; peer review: 3 approved]. F1000Research 2013, 2:46 (https://doi.org/10.5256/f1000research.300.r933)
NOTE: it is important to ensure the information in square brackets after the title is included in all citations of this article.
Views
9
Cite
Reviewer Report 17 Apr 2013
Rhona Mirsky, Department of Cell and Developmental Biology, University College London, London, UK 
Approved
VIEWS 9
The title and abstract are appropriate for the content of the article. The article is clearly written, and the design, methods and analysis are appropriate.  The article shows that the mutation is due to deletion of exons 10-14 of the ... Continue reading
CITE
CITE
HOW TO CITE THIS REPORT
Mirsky R. Reviewer Report For: The stretcher spontaneous neurodegenerative mutation models Charcot-Marie-Tooth disease type 4D [version 1; peer review: 3 approved]. F1000Research 2013, 2:46 (https://doi.org/10.5256/f1000research.300.r899)
NOTE: it is important to ensure the information in square brackets after the title is included in all citations of this article.

Comments on this article Comments (0)

Version 1
VERSION 1 PUBLISHED 13 Feb 2013
Comment
Alongside their report, reviewers assign a status to the article:
Approved - the paper is scientifically sound in its current form and only minor, if any, improvements are suggested
Approved with reservations - A number of small changes, sometimes more significant revisions are required to address specific details and improve the papers academic merit.
Not approved - fundamental flaws in the paper seriously undermine the findings and conclusions
Sign In
If you've forgotten your password, please enter your email address below and we'll send you instructions on how to reset your password.

The email address should be the one you originally registered with F1000.

Email address not valid, please try again

You registered with F1000 via Google, so we cannot reset your password.

To sign in, please click here.

If you still need help with your Google account password, please click here.

You registered with F1000 via Facebook, so we cannot reset your password.

To sign in, please click here.

If you still need help with your Facebook account password, please click here.

Code not correct, please try again
Email us for further assistance.
Server error, please try again.