ALL Metrics
-
Views
-
Downloads
Get PDF
Get XML
Cite
Export
Track
Research Article
Revised

In silico analysis of molecular mimicry between human aquaporin 3, Aspergillus fumigatus aquaporin and aquaporins from allergic sources

[version 2; peer review: 2 approved]
PUBLISHED 12 Sep 2024
Author details Author details
OPEN PEER REVIEW
REVIEWER STATUS

This article is included in the Bioinformatics gateway.

Abstract

Background

Atopic dermatitis (AD) is a chronic inflammatory skin condition that has a significant impact on quality of life. The immune response and allergy symptoms in AD are triggered by the recognition of specific allergens by IgE antibodies. Cross-reactivity can lead to auto-IgE responses, potentially worsening AD symptoms. Our research aimed to enhance our understanding of allergenic sources, including A. fumigatus, and their role in AD. We focused on molecular mimicry between human AQP3 and A. fumigatus aquaporin.

Methods

In our in-silico analysis, we compared the amino acid sequences of human aquaporin 3 (AQP3) and A. fumigatus aquaporin with 25 aquaporins from various allergenic sources, sourced from the UniProt and NCBI databases. Phylogenetic relationship analysis and homology-based modeling were conducted. We identified conserved antigenic regions located within the 3D structures.

Results

The global identity levels among the studied aquaporins averaged 32.6%. One antigenic site exhibited a remarkable local region, with a conserved identity of 71.4%. We categorized the aquaporins into five monophyletic clades (A–E), with group B showing the highest identity (95%), including six mammalian aquaporins, including AQP3. When comparing A. fumigatus aquaporins, the highest identity was observed with Malassezia sympodialis at 35%. Both human and A. fumigatus aquaporins have three linear and three discontinuous epitopes.

Conclusions

We identified potential linear and conformational epitopes of AQP3, indicating a possible molecular mimicry between humans and A. fumigatus aquaporins. This suggests autoreactivity and potential cross-reactivity, although further validation using in vitro and in vivo experiments is required.

Keywords

Atopic dermatitis, in silico, molecular mimicry, Aspergillus fumigatus, aquaporins.

Revised Amendments from Version 1

The corrections were made, and information related to non-IgE responses was included.

To read any peer review reports and author responses for this article, follow the "read" links in the Open Peer Review table.

Introduction

Atopic dermatitis (AD) is a chronic and recurrent inflammatory skin disorder characterized by symptoms, such as eczema, erythema, persistent itching, and continuous skin damage. Over the past 30 years, the prevalence of AD has shown a notable rise, affecting between 5% and 20% of the child population and approximately 7% of adults in industrialized countries.1,2 The pathogenesis of AD is not completely clear; however, allergens can activate an intense Th2 response.3 While IgE-mediated pathways are prominent in atopic dermatitis, non-IgE mechanisms also play a crucial role, particularly in contact dermatitis and in some cases of atopic dermatitis where patients do not exhibit elevated IgE levels. Allergenic sources can vary depending on the population; for example, house dust mites are the main source of sensitization in tropical countries, whereas in Europe, pollen is the main trigger for allergies. In addition, depending on the environmental conditions, it is possible to be exposed to different species; therefore, epidemiological studies have shown variations in the frequencies of sensitization.4 The severity of the disease is influenced by several factors, including compromised skin barrier integrity due to reduced levels of filaggrins and ceramides as well as an elevated presence of water channels such as aquaporin, which drives the skin, making the patient more susceptible to atopic dermatitis.5 In general, allergy management includes allergen avoidance, pharmacotherapy, and immunotherapy, where only the latter has a beneficial effect that lasts for years and allows for a reduction in anti-inflammatory treatment.68

In addition to other environmental factors, the skin microbiome plays a pivotal role in AD development. Aspergillus fumigatus is an opportunistic pathogen in both poikilothermic and homeothermic animals. In humans, this pathogen has been associated with many pathologies such as invasive cutaneous aspergillosis, saprophytic lung colonization, and aspergillomas. In addition, A. fumigatus can induce IgE-mediated allergic diseases including rhinitis, allergic sinusitis, asthma, hypersensitivity pneumonitis, and AD.9,10 It has been characterized as an important allergenic source, and some allergens, including thioredoxins and cyclophilins, share homology with human proteins and are implicated in the autoreactive response in AD.

Despite the identification of sensitization to extracts from allergenic sources, such as fungi, the recognition of specific IgE sensitization to allergens is necessary to carry out a better diagnosis and immunotherapy.11 However, this represents a challenge, because most fungal allergens cross-react with other taxonomically distant species, making it difficult to prove the clinical relevance of IgE reactivity against these allergens. In addition, it is important to consider that the evolution of AD varies greatly among patients with this disease and can be triggered by different factors. For example, in A. fumigatus and AD, studies suggest that specific IgE-mediated activation is induced not by multiple allergens and not by a few major allergens, as is the case with asthma and rhinitis.12,13 Another problem presented by the diagnosis of allergic diseases associated with A. fumigatus is the lack of standardized allergens for preparation of molecular component tests. Therefore, the discovery of new fungal allergens and the identification of the prevalence of these new components may provide an opportunity to learn more about the pathology of atopic dermatitis, improving the diagnosis and treatment of this disease.

In recent years, aquaporin has become a candidate protein for the study of skin and allergic diseases such as AD, given its role in epidermal hydration and the transport of various substances such as glycerol, salts, and exocrine fluids, favoring dry skin and allergen leakage.14 They have also been associated with various atopic diseases, such as glaucoma, cancer, epilepsy, obesity, epidermal hyperplasia, and neuromyelitis optical, among others. In AD, an increase in the expression of aquaporin 3 has been observed, which may be related to water loss and the severity of the disease, in contrast to healthy individuals who maintain a balanced expression of this protein in the basal, horny, and spinous layers.5 The consequences of aquaporin 3 (AQP3) overexpression extend beyond cutaneous water retention as it becomes a target for the exacerbated immune response in AD inflammation. This hypothesis suggests that it may be recognized by human autoantibodies, which, due to the persistence of self-protein exposure, contribute to increased inflammation and chronicity of AD.

Additionally, this protein is present in most organisms with a wide variety of isoforms and functions throughout the taxonomic framework. Recently, aquaporin has been identified in highly allergenic species, such as house dust mites. In a study carried out by Mao et al., describing the Dermatophagoides farinae proteome, two-dimensional immunoblotting was performed, which showed binding with IgE antibodies in a band that has the same isoelectric point and molecular weight of the aquaporin family, suggesting its possible role as an allergen. The objective of this study was to perform an in silico analysis to investigate the potential molecular mimicry between human aquaporins and those from A. fumigatus, as well as various allergenic sources.

Methods

For the selection of aquaporins, the Aspergillus fumigatus (KEY82230) and human aquaporin 3 (Q92482) sequences of interest were compared with existing allergenic protein sequences using Allermatch (https://allermatch.org/), an allergen comparative server that allows allergen sequence alignment; therefore, those with high identity values were chosen. The sequence pool was obtained from the UniProt (https://www.uniprot.org/) and National Center for Biotechnology Information (NCBI) databases. Given the diversity in amino acid origins and lengths across the molecules under examination, we employed coverage and identity values to gauge the extent of their relationships. The identity and coverage values between the molecules used in this study were determined using the EMBOSS Needle (https://www.ebi.ac.uk/Tools/psa/emboss_needle/), specialized for performing paired alignments, and the web server from Praline (http://www.ibi.vu.nl/), which allowed for paired and multiple alignments. When carrying out the alignment, it was considered that the sequences were different and came from different sources; therefore, the alignment parameters were set to utilize the BLOSUM62 matrix, which primarily assesses evolutionary divergence, along with adjustments to the conditional scoring matrix.15,16

Phylogenetic analysis

To construct the phylogenetic tree, we conducted a study using “Molecular Evolutionary Genetic Analysis” (MEGA) version 11 program. We employed the neighbor-joining (R) reconstruction method, supported by 100 bootstrap repetitions, to ensure the reliability and robustness of the analysis. Evolutionary distances were computed using the Poisson correction method, which uses a comparison matrix to identify sequence similarities. This matrix was created based on all amino acid sequences of the selected allergens, with all empty gaps removed (full deletions). Branch length summation (SBL) was presented as a measure of overall comparison and homologies, providing insights into the number of nodes, their positions, and the formation of the evolutionarily closest sequence “clusters.15,17

3D models of proteins

Aquaporin models were acquired from the Protein Data Bank and AlphaFold (Homo sapiens, Felis catus, Equus caballus, Bos taurus, Mus musculus, Malassezia sympodialis, Saccharomyces cerevisiae, Penicillium chrysogenum, Escherichia coli). For A. fumigatus and Cannis lupus familiaris aquaporin 3D structures were modeled by homology using the Swiss Model server (https://swissmodel.expasy.org/), and these models were refined in ModRefiner. (https://zhanggroup.org/ModRefiner/), an algorithm for the fine-grained refinement of protein structures at the atomic level.18

Epitope prediction

Models were used to locate possible epitope regions predicted by the Ellipro server (http://tools.iedb.org/ellipro/), which was used to predict linear and discontinuous epitopes in the aquaporins of A. fumigatus, (AQP3), Cannis lupus familiaris, Felis catus, Equus caballus, Bos taurus, Mus musculus, Malassezia sympodialis, Saccharomyces cerevisiae, Penicillium chrysogenum and Escherichia coli. The potential epitopes were selected under the criteria of a score ≥ 7, as this value evaluates how exposed the residue is and the binding capacity of the epitope with the paratope.15,17

Identification of aquaporin domains

The characterization of the protein domains was carried out using the Interpro web server (https://www.ebi.ac.uk/interpro/); with this bioinformatic tool we obtained those domains with functional activity present in the protein sequence of the aquaporins studied. Subsequently, a review of the tertiary structure was carried out using the PyMOL program, which functioned as a molecular viewer, allowing identification of the location of the protein domains in the tertiary structure of each one.

Results

Aquaporins sequence alignments

A total of 25 aquaporin sequences from different sources were selected and compared with the A. fumigatus aquaporin and human aquaporin (Table 1), the identity percentages of the aquaporins from different sources Vs A. fumigatus aquaporin and AQP3 are shown in Table 2. Notably, human AQP3 exhibited maximum values of identity and similarity of 95.5% and 98.6%, respectively, with aquaporin allergy sources. When comparing A. fumigatus aquaporins and AQP3, an identity of 32.6% and a similarity of 47.5% were observed, indicating a significant degree of homology between them. Regarding the AQP of A. fumigatus, the highest identity values were observed in the AQP of M. simpodialies (35%), followed by the mammalian species that also had greater identity with human AQP3, such as C. familiaris (33, 9%), Felis gatus (33, 10%), Mus musculus (33, 10%), and Bos taurus (32, 80%). The lowest identity and similarity results were obtained with apple (Malus domestica), with values of 0.2% and 0.9%, respectively.

Table 1. Aquaporins studies.

OrganismsProteinUniprot/NCBI EntryAminoácidos
Aspergillus fumigatusaquaglyceroporinKEY82230335
Homo sapiensAquaporin-3Q92482292
Dermatophagoides pteronyssinusAquaporinA0A2D1VL80265
Dermatophagoides farinaeAquaporinA0A2C9PGE6259
Blomia tropicalisAquaporinA0A1Z1W2B1256
Euroglyphus mayneiAquaporin-like proteinA0A1Y3AUR4289
Malus domesticaAquaporinH2EIG5144
Vitis viníferaAquaporin TIP4-1A0A438K8X4196
Actinidia deliciosaAquaporin PIP2-1A0A1X9ZIG1283
Citrus sinensisPutative aquaporin TIP13A0A067DDA2251
Cannabis sativaUncharacterized proteinA0A7J6FF47250
Blatella germanicaAquaporin TIP3-1A0A2P8XIM1200
Periplaneta americanaPutative glycerol diffusion channelD0J8Y8247
Penaeus vannameiAquaporinA0A3R7PEU6308
Canis lupus familiarisAquaporin-3E2RI15292
Felis catusAquaporin-3A0A2I2UBV1292
Equus caballusAquaporin-3F6TFP8419
Bos TaurusAquaporin-3Q08DE6292
Mus musculusAquaporin-3Q8R2N1292
Alternaria alternataAquaporinA0A177DNX7408
Malassezia SympodialisPutative channel-like proteinA0A1M7ZZV8291
Saccharomyces cerevisiaeAquaglycerol porin AQY3P43549646
Penicillium chrysogenumAquaporin-3A0A167PPH9279
Penicillium rubensPc12g14590 proteinB6H130306
Escherichia coliGlycerol uptake facilitator proteinP0AER0281
Ascaris lumbricoidesAquaporinA0A0M3I310267
Staphylococcus aureusGlycerol uptake facilitator proteinAYU99483247

Table 2. Identity and similarity between AQP3, A. fumigatus aquaporin and aquaporins from allergen sources.

SourcesAQP3Aspergillus Fumigatus
Identity (%)Similarity (%)ScoreIdentity (%)Similarity (%)Score
Aspergillus fumigatus32,647,5492,5---
Dermatophagoides pteronyssinus18,132,242,015,5025,541
Dermatophagoides farinae31,548,7386,022,9036291
Blomia tropicalis19,632,744,513,702029
Euroglyphus maynei294636021,8034,6252,5
Malus domestica1,73,214,50,200,93
Vitis vinifera1,730,517518,2027,7149,5
Actinidia deliciosa21,232,9218,524,3038247
Citrus sinensis25,438,4193,518,8029,6167
Cannabis sativa24,639190,519,5034,7167
Blatella germanica22,633,4141,015,9023,284,5
Periplaneta americana27,144,433224,2034330
Penaeus vannamei14,928,580,513,0020,227
Canis lupus familiaris72,975,9129433,9050,3468,5
Felis catus95,597,6148433,1048,4508,5
Equus caballus66,668,7149727,9042,7498
Bos taurus94,998,3148632,8048,1497,5
Mus musculus95,598,6149333,1048,1506,5
Alternaria alternata15,625,421414,5022,6205
Malassezia Simpodiales33,149,5401,535,9049,6516
Saccharomyces cerevisiae15,825,151622,6031,4668,5
Penicillium chrysogenum33,250,9377,53,5043,4477
Penicillium rubens24,635,220520,9032,8144,5
Escherichia coli35,653,2475,531,7045,2436,5
Ascaris lumbricoides9,916,130,510,4016,717,5
Staphylococcus aureus31,743,6377,527,7037,4337,5

Phylogenetic analysis

Phylogenetic relationships were determined using the neighbor-joining method, incorporating all 27 amino acid sequences. The resulting phylogenetic tree is presented in a circular format in Figure 1. Evolutionary distances were calculated using the Poisson correction method and were exprex|ssed as the number of amino acid substitutions per site. The tree visually represents the grouping and arrangement of the analyzed aquaporins, facilitating a comprehensive comparison and revealing their interrelatedness.

7e523b69-23af-4d7e-9607-9e948ddaca79_figure1.gif

Figure 1. Phylogenetic tree based on amino acid sequences of the studied aquaporins.

The sums of branch lengths for an optimal tree totaled 12.5. The tree reveals the formation of five groups, designated as letters from A to E.

Based on branch distances, the phylogenetic tree presented the formation of five distinct groups, denoted as letters A to E. Multiple sequence alignments were performed using the Praline server to further explore the similarities within each group. Group A consisted of fungal species with a shared identity of 39%, whereas group B comprised mammalian aquaporins with a high identity of 95%. Group C was composed of two mite species with an identity of 53%, group D encompassed plant sources with 40% identity, and group E included pathogens and mites with an identity of 31%. Notably, this analysis revealed significant allergen sources in tropical regions, such as D. pteronissinus and B. tropicalis.

Species such as P. americana, S. aureus, E. coli, B. germanica, and M. domestica did not fit within any specific group because of their substantial branch distances from the root of clustering. Consequently, they were categorized into independent groups. Among the identified groups, those most closely related to the aquaporins of A. fumigatus and humans were found in groups A and B. Additionally, noteworthy proximity was observed between E. coli and D. farinae in group B.

The guidance provided by the phylogenetic tree and the results of paired alignments of the EMBOSS needle and aquaporin sequences were selected with a score ≥380. This threshold ensured an identity greater than 30% for each aquaporin sequence. Subsequently, paired alignments of the selected aquaporins against A. fumigatus were performed using Praline. This approach provides a more visually informative result, enabling a better understanding of the conserved regions in each sequence (Figure 2). By employing this screening process, we can identify more conserved sequences, thus increasing the likelihood of identifying regions that may contain potential epitopes.

7e523b69-23af-4d7e-9607-9e948ddaca79_figure2.gif

Figure 2. Sequence alignment of aquaporins from A. fumigatus and humans was performed using Praline.

The colors used in the alignment represent the level of sequence conservation, with blue indicating lower conservation and red indicating higher conservation. In the accompanying image, highlighted boxes denote the most conserved regions in the sequence, with each color (red, yellow, and green) representing the degree of conservation in descending order.

Aquaporin 3D models

Using PyMOL, we visualized the structures of the 12 selected aquaporin proteins. They were represented in the form of “cartoons” and were color-coded using the spectrum. These models exhibit the characteristic structure of aquaporins, consisting of six alpha helices connected by extracellular and intracellular “loops” that form the water and substance transport channel (Figure 3).

7e523b69-23af-4d7e-9607-9e948ddaca79_figure3.gif

Figure 3. Structures of aquaporins obtained from sources including PDB, Uniprot, AlphaFold, and Swiss-model. Their clustering corresponds to the arrangement in the phylogenetic tree. (A) This cluster comprises aquaporins from fungi. (B) Aquaporins from animals, except for E. coli, belong to this group.

Moreover, certain structures display distinctive extensions in their amino acid chains, resulting in variations in their tertiary structures. Examples include S. cerevisiae and E. caballus. Consequently, during epitope exploration, most of these regions were exposed, leading to the exclusion of these sequences as potential allergenic sources due to the absence of epitopes in the conserved regions of interest. This minimized the likelihood of cross-reactivity.

Prediction of linear and discontinuous epitopes

Using the 3D structures of A. fumigatus, Homo sapiens, Dermatophagoides farinae, Canis lupus familiaris, Felis catus, Equus caballus, Bos taurus, Mus musculus, Malassezia Sympodialis, Saccharomyces cerevisiae, Penicillium chrysogenum, and Escherichia coli, we predicted the linear and discontinuous epitopes for each aquaporin (Table 3). We utilized PyMOL to analyze the identified linear and conformational epitopes, and thoroughly examined the distinct regions within each of these 3D structures. These epitopes are marked with the representative colors in the 3D structure. Although this characterization was performed for all 12 studied aquaporins, this work focused only on the epitopes found in the aquaporins of interest (A. fumigatus and AQP3), as shown in Figures 4 and 5.

Table 3. Lineal and discontinuous epitotpes from A. fumigatus and human aquaporin 3 (AQP3).

Aspergillus Fumigatus aquaporin
Lineal Epitopes
No.ChainStartFinalPeptideN. ResiduesScore
1A218231DDGNIGAGPLTPLA140,763
2A8093QVTLSKGEKGDYQS130,7
3A151180AIVYGNYRSAIDQFEGGAHIRTVPGYSPTA300,7
Discontinuous Epitopes
1A5461A:R54, A:T55, A:Y56, A:C57, A:R58, A:D59, A:A60, A:F6180,869
2A211306A:F211, A:F293, A:G295, A:W296, A:I297, A:Y298, A:D299, A:M300, A:F301, A:L302, A:Y303, A:T304, A:G305, A:T306140,815
3A215234A:A215, A:D218, A:D219, A:G220, A:N221, A:I222, A:G223, A:A224, A:G225, A:P226, A:L227, A:T228, A:L230, A:A231, A:F234150,763
Human Aquaporin 3
Lineal Epitopes
1A123MGRQKELVSRCGEMLHIRYRLLR230,872
2A259292FVYQLMIGCHLEQPPPSNEEENVKLAHVKHKEQI340,856
3A4558QVVLSRGTHGGFLT140,709
4A120143FGLYYDAIWHFADNQLFVSGPNGT240,702
Discontinuous Epitopes
1A15A:M1, A:G2, A:R3, A:Q4, A:K550,957
2A271285A:Q271, A:P272, A:P273, A:P274, A:S275, A:N276, A:E278, A:E279, A:N280, A:V281, A:K282, A:L283, A:A284, A:H285140,914
3A6103A:E6, A:L7, A:V8, A:S9, A:R10, A:C11, A:G12, A:E13, A:M14, A:L15, A:H16, A:I17, A:L21, A:L22, A:R23, A:L26, A:E96, A:P97, A:I99, A:P102, A:I103210,775
7e523b69-23af-4d7e-9607-9e948ddaca79_figure4.gif

Figure 4. Depiction of predicted linear epitopes.

All epitopes are color-coded on the surface models. Red, green, blue, and yellow correspond to the highest values, respectively.

7e523b69-23af-4d7e-9607-9e948ddaca79_figure5.gif

Figure 5. Representation of predicted discontinuous epitopes from A. fumigatus aquaporin and AQP3. All epitopes are highlighted with color on the surface models, where red, green, and blue signify the highest values, respectively.

Furthermore, the PyMOL visualization program allowed us to calculate the root mean standard deviation (RMSD), which measures the structural similarity between two aligned objects, specifically the proteins of interest (Figure 6). The closer the RMSD value is to zero, the stronger the molecular similarity between the proteins. We obtained an RMSD value of 1.003, indicating a significant molecular similarity.

7e523b69-23af-4d7e-9607-9e948ddaca79_figure6.gif

Figure 6. The structural overlap of A. fumigatus aquaporin (magenta) and human aquaporin AQP3 (cyan) is depicted in a cartoon model. The root-mean-square deviation (RMSD) is 1.003.

In addition, we identified epitopes that contained conserved sequences. In the case of fungal aquaporins, Linear Epitope (LE) 2 was identified, whereas in human aquaporins, LE 3 was found. Individual analysis revealed highly conserved fragments with more than four residues. For fungal aquaporins, the conserved residue is 80QVTLSKG86, whereas for human aquaporins, it is 45QVVLSRG52. The percentage of identity and similarity between these fragments was 71.4% and 85.7%, respectively, suggesting that these residues were highly likely to be antigenic patches (Figures 7 and 8).

7e523b69-23af-4d7e-9607-9e948ddaca79_figure7.gif

Figure 7. Potential similar antigenic patches in linear epitopes of A. fumigatus aquaporin and AQP3.

7e523b69-23af-4d7e-9607-9e948ddaca79_figure8.gif

Figure 8. Identification of transmembrane functional activity domains in the aquaporin proteins of human AQP3 and the fungus A. fumigatus through color-coded assignment in their secondary structure.

Discussion

Numerous diseases, including atopic dermatitis, bullous pemphigoid, chronic spontaneous urticaria, and multiple sclerosis, are associated with the presence of IgE autoantibodies. In the context of allergic responses intertwined with autoimmunity, researchers have categorized autoantigens that bind to IgE into three functional groups: 1) autoantigens that share sequence homology with environmental allergens, 2) autoantigens that lack sequence homology with known environmental allergens, and 3) chemically modified autoantigens. However, the identification of environmental allergens with homology to human proteins and their influence on the allergic response vary among these autoantigens, and their clinical significance often remains unclear.19

Aquaporin is a promising protein candidate for studying cutaneous, autoimmune, and allergic diseases, including atopic dermatitis (AD), because of its involvement in epidermal hydration and transportation of various substances such as glycerol, salts, and exocrine fluids. These functions contribute to skin dryness, which, in turn, facilitates the filtration of allergens.14 This protein is widely present in numerous organisms, and exhibits a diverse range of isoforms and functions across different taxonomic groups.

Recent research has identified the presence of aquaporins in allergenic species such as dust mites.20 Mao et al. characterized the proteome of Dermatophagoides farinae, and two-dimensional immunoblotting revealed the binding of IgE antibodies to a band with the same isoelectric point and molecular weight as the aquaporin family, suggesting its potential role as an allergen.21

On the other hand, in a systematic review, a total of 32 articles were examined to assess the role of the microbiota in atopic dermatitis. The microbiome profile revealed substantial variation in bacterial diversity along with an increased presence of fungi. Notably, there was diversification and expansion of species belonging to the genus Aspergillus within the fungal group, whereas a reduction in the number of Malassezia spp. was observed. Research has also demonstrated that A. fumigatus is a prominent source of sensitization in patients with severe atopic dermatitis. Additionally, the presence of new allergens from this species is believed to have a significant impact on the severity of the condition.22

The comprehensive analysis of aquaporins provides guidance for considering other potential allergenic sources beyond the main aquaporins studied, namely AQP3 and A. fumigatus aquaporin. We conducted a comparative analysis of 25 aquaporin sequences from various sources, including A. fumigatus aquaporin and human aquaporin 3 (AQP3). A comparison between A. fumigatus aquaporin and AQP3 revealed an identity of 32.6% and similarity of 47.5%, indicating a relevant level of homology between these two proteins despite the evolutionary gap and taxonomic diversification among species. Notably, human AQP3 exhibited the maximum identity and similarity values of 95.5% and 98.6%, respectively. These high values could be attributed to the inclusion of aquaporins from mammalian allergen sources. Given that these species belong to a taxonomic group closer to humans, it is understandable that the APQs are more conserved.

Five clades were constructed for the phylogenetic analysis. A and B showed the highest identity with A. fumigatus aquaporins and AQP3. The alignment results suggest that divergence among aquaporins primarily occurs in smaller species, while it remains conserved in mammals. In addition, the presence of aquaporin isoforms, each with special functions and locations, such as AQP3, indicates functional and phenotypic variability among different cell types within the same organism. However, despite this diversity, the identity of aquaporins within the clades revealed values higher than 30%, particularly in clade B (95%), indicating that if the protein is recognized by antibodies, potential cross-reactivity among these species can occur.

Only a limited number of studies have investigated the relationship between aquaporins derived from allergenic sources and their potential relevance in human diseases. Zhou et al. conducted an assessment using transcriptomics to identify potential AQPs in Blomia tropicalis using molecular cloning techniques, followed by a comparative analysis of identity among mite aquaporin sequences and human aquaporins. The author identified five putative AQP-coding sequences, known as BlotAQP1-5, which were indexed into all three subgroups: AQPs, aquaglyceroporins, and superAQPs. BlotAQP1, BlotAQP2, and BlotAQP5 were clustered with the aquaglyceroporins hAQP3, hAQP7, hAQP9, and hAQP10, with a common sequence consensus ‘N-G-NPSRD-PRL.’ The molecular weight and isoelectric point of these molecules were consistent with the findings reported by Mao et al. in their two-dimensional electrophoresis study.23 This observation suggests the potential recognition of aquaporins, specifically aquaglycerins such as AQP3, by IgE in patients with allergies. These results are consistent with those presented in our findings, where despite the evolutionary distance between species, there is an identity exceeding 30% and consensus sequences that may serve as potential antigenic patches.

In contrast, in regions where higher conservation was observed among the sequences, neither linear nor conformational epitopes were identified. This is attributed to the fact that these sequences are in the transmembrane region of the protein, which limits their accessibility to antibodies. However, despite the absence of epitopes, these conserved regions are interesting. During cell lysis caused by mechanical injury or microbial effects, these proteins can be linearly exposed, leading to the emergence of neoepitopes that can be recognized by IgE or phagocytic cells.24

Although little is known about the role of AQP3 as an allergen or autoantigen, other aquaporins have been studied for their relevance as antigens in autoimmune diseases. Sagan et al. investigated the relevance of AQP4 as an autoantigen in neuromyelitis optica, recognized by T lymphocytes, in an animal model.25 This aquaporin is a water channel expressed in astrocytes in areas in contact with the blood-brain barrier, and 75% of patients with neuromyelitis have antibodies capable of recognizing AQP4. Therefore, the relevance of human aquaporins found in other tissues, such as AQP3 in the skin, can be considered as potential autoantigens and, through molecular mimicry, triggers relevant skin diseases such as atopic dermatitis.26 Evidence indicates cross-reactivity with aquaporins expressed by bacteria and mycobacteria, including Escherichia coli and Mycobacterium species, in relation to this specific autoantigen.27 This indicated that antibodies targeting aquaporins from A. fumigatus could potentially recognize and target this autoantigen. In a previous study, we found that AQP4 exhibits only one predicted cross-reactive epitope. It has been postulated that the recognition of a single epitope by autoantibodies could trigger an epitope spreading mechanism, leading to the involvement of additional autoantigens in the immune response.28 For both A. fumigatus aquaporins and AQP3, a total of four linear epitopes and three discontinuous epitopes were described. Structural superimposition highlighted a notable degree of similarity between the proteins, indicating that the epitopes could reside within the corresponding antigenic regions. This observation supports the idea of a potential molecular mimicry between these proteins.

It is important to acknowledge that our study has several limitations. In silico modeling and epitope prediction analyses are not definitive, and there may be variations in the actual structure compared with our proposed models. Nonetheless, bioinformatic analyses offer several advantages in directing research resources efficiently. They play a crucial role in the preliminary assessment of hypotheses and help to determine whether it is justified to proceed with in vitro or ex vivo experiments. Also, AD is traditionally associated with IgE-mediated allergic responses, with elevated serum IgE levels and sensitization to environmental allergens. However, new evidence highlights the importance of considering non-IgE mechanisms in the pathogenesis and management of AD induce by A. fumigatus.29,30 These non-IgE pathways contribute to the complexity of the disease and have significant implications for understanding its clinical variability, diagnosis, and treatment strategies and they should be considered in future studies of AQP as a trigger for atopic dermatitis.

Conclusion

During alignment of aquaporin sequences from A. fumigatus and AQP3, specific conserved epitopes were observed. Analysis revealed that the local sequence identity exceeded 70%, indicating molecular mimicry in these regions of both aquaporins. Further investigation of epitopes and domain identification revealed the most conserved region in transmembrane domains 12 and 14 of the respective aquaporins. This study represents a groundbreaking contribution to the exploration and analysis of aquaporin as a potential allergen and autoallergen in atopic dermatitis, as it is the first known study to focus on this subject. To confirm cross-reactivity, future in vitro studies are needed to demonstrate the IgE-binding capacity in these regions.

By acquiring knowledge regarding the sequences and structures of potential epitopes from different allergenic sources, we can modify and synthesize these molecules for future in vitro and in vivo studies. This not only expands the literature in the field of immunotherapy but also facilitates the diagnosis and treatment of autoimmune diseases such as atopic dermatitis. It is important to note that in silico tests optimize these studies by providing rapid results and circumventing the high costs associated with laboratory testing.

Comments on this article Comments (0)

Version 2
VERSION 2 PUBLISHED 23 Apr 2024
Comment
Author details Author details
Competing interests
Grant information
Copyright
Download
 
Export To
metrics
Views Downloads
F1000Research - -
PubMed Central
Data from PMC are received and updated monthly.
- -
Citations
CITE
how to cite this article
Sánchez A, Padilla Y, Lorduy A et al. In silico analysis of molecular mimicry between human aquaporin 3, Aspergillus fumigatus aquaporin and aquaporins from allergic sources [version 2; peer review: 2 approved]. F1000Research 2024, 13:358 (https://doi.org/10.12688/f1000research.142843.2)
NOTE: If applicable, it is important to ensure the information in square brackets after the title is included in all citations of this article.
track
receive updates on this article
Track an article to receive email alerts on any updates to this article.

Open Peer Review

Current Reviewer Status: ?
Key to Reviewer Statuses VIEW
ApprovedThe paper is scientifically sound in its current form and only minor, if any, improvements are suggested
Approved with reservations A number of small changes, sometimes more significant revisions are required to address specific details and improve the papers academic merit.
Not approvedFundamental flaws in the paper seriously undermine the findings and conclusions
Version 2
VERSION 2
PUBLISHED 12 Sep 2024
Revised
Views
11
Cite
Reviewer Report 20 Sep 2024
Celso Eduardo Olivier, American Institute Alergoimuno, Americana, Brazil 
Approved
VIEWS 11
The version 2 is ... Continue reading
CITE
CITE
HOW TO CITE THIS REPORT
Olivier CE. Reviewer Report For: In silico analysis of molecular mimicry between human aquaporin 3, Aspergillus fumigatus aquaporin and aquaporins from allergic sources [version 2; peer review: 2 approved]. F1000Research 2024, 13:358 (https://doi.org/10.5256/f1000research.171499.r323088)
NOTE: it is important to ensure the information in square brackets after the title is included in all citations of this article.
Version 1
VERSION 1
PUBLISHED 23 Apr 2024
Views
11
Cite
Reviewer Report 24 Jul 2024
Elizabeth Garcia, Fundacion Santa Fe de Bogota, Bogotá, Bogota, Colombia 
Approved
VIEWS 11
The present study offers key insights into the potential immunological cross-reactivity between human and fungal aquaporins.
  • Major highlights include the discovery of substantial sequence and structural homology, which indicates possible sites for cross-reactivity, and the epitope
... Continue reading
CITE
CITE
HOW TO CITE THIS REPORT
Garcia E. Reviewer Report For: In silico analysis of molecular mimicry between human aquaporin 3, Aspergillus fumigatus aquaporin and aquaporins from allergic sources [version 2; peer review: 2 approved]. F1000Research 2024, 13:358 (https://doi.org/10.5256/f1000research.156440.r297871)
NOTE: it is important to ensure the information in square brackets after the title is included in all citations of this article.
Views
21
Cite
Reviewer Report 13 Jul 2024
Celso Eduardo Olivier, American Institute Alergoimuno, Americana, Brazil 
Approved with Reservations
VIEWS 21
It is a well-executed in-silico analysis comparing the amino acid sequences of human aquaporin 3  and Aspergillus fumigatus aquaporin with 25
aquaporins from various allergenic sources researched from the UniProt and NCBI databases. However, in "background," "introduction," and "discussion," ... Continue reading
CITE
CITE
HOW TO CITE THIS REPORT
Olivier CE. Reviewer Report For: In silico analysis of molecular mimicry between human aquaporin 3, Aspergillus fumigatus aquaporin and aquaporins from allergic sources [version 2; peer review: 2 approved]. F1000Research 2024, 13:358 (https://doi.org/10.5256/f1000research.156440.r301819)
NOTE: it is important to ensure the information in square brackets after the title is included in all citations of this article.

Comments on this article Comments (0)

Version 2
VERSION 2 PUBLISHED 23 Apr 2024
Comment
Alongside their report, reviewers assign a status to the article:
Approved - the paper is scientifically sound in its current form and only minor, if any, improvements are suggested
Approved with reservations - A number of small changes, sometimes more significant revisions are required to address specific details and improve the papers academic merit.
Not approved - fundamental flaws in the paper seriously undermine the findings and conclusions
Sign In
If you've forgotten your password, please enter your email address below and we'll send you instructions on how to reset your password.

The email address should be the one you originally registered with F1000.

Email address not valid, please try again

You registered with F1000 via Google, so we cannot reset your password.

To sign in, please click here.

If you still need help with your Google account password, please click here.

You registered with F1000 via Facebook, so we cannot reset your password.

To sign in, please click here.

If you still need help with your Facebook account password, please click here.

Code not correct, please try again
Email us for further assistance.
Server error, please try again.