ALL Metrics
-
Views
-
Downloads
Get PDF
Get XML
Cite
Export
Track
Research Article

In silico identification of vaccine targets for 2019-nCoV

[version 1; peer review: 2 approved]
PUBLISHED 25 Feb 2020
Author details Author details
OPEN PEER REVIEW
REVIEWER STATUS

This article is included in the Emerging Diseases and Outbreaks gateway.

This article is included in the Coronavirus (COVID-19) collection.

Abstract

Background: The newly identified coronavirus known as 2019-nCoV has posed a serious global health threat. According to the latest report (18-February-2020), it has infected more than 72,000 people globally and led to deaths of more than 1,016 people in China.
Methods: The 2019 novel coronavirus proteome was aligned to a curated database of viral immunogenic peptides. The immunogenicity of detected peptides and their binding potential to HLA alleles was predicted by immunogenicity predictive models and NetMHCpan 4.0.
Results: We report in silico identification of a comprehensive list of immunogenic peptides that can be used as potential targets for 2019 novel coronavirus (2019-nCoV) vaccine development. First, we found 28 nCoV peptides identical to Severe acute respiratory syndrome-related coronavirus (SARS CoV) that have previously been characterized immunogenic by T cell assays. Second, we identified 48 nCoV peptides having a high degree of similarity with immunogenic peptides deposited in The Immune Epitope Database (IEDB). Lastly, we conducted a de novo search of 2019-nCoV 9-mer peptides that i) bind to common HLA alleles in Chinese and European population and ii) have T Cell Receptor (TCR) recognition potential by positional weight matrices and a recently developed immunogenicity algorithm, iPred, and identified in total 63 peptides with a high immunogenicity potential.
Conclusions: Given the limited time and resources to develop vaccine and treatments for 2019-nCoV, our work provides a shortlist of candidates for experimental validation and thus can accelerate development pipeline.

Keywords

Coronavirus, adaptive immunity, immunogenicity, T cell cross-reactivity, vaccine development

Introduction

The emergence and rapid spread of the recent novel coronavirus known as 2019-nCoV has posed a serious global health threat1 and has already caused a huge financial burden2. It has further challenged the scientific and industrial community for quick control practices, and equally importantly to develop effective vaccines to prevent its recurrence. In facing a rapid epidemical outbreak to a novel and unknown pathogen, a key bottleneck for a proper and deep investigation, which is fundamental for vaccine development, is the limited -- to almost no -- access of the scientific community to samples from infected subjects. As such, in silico predictions of targets for vaccines are of high importance and can serve as a guidance to medical and experimental experts for the best and timely use of the limited resources.

In this regard, we report our recent effort to computationally identify immunogenic and/or cross-reactive peptides from 2019-nCoV. We provide a detailed screen of candidate peptides based on comparison with immunogenic peptides deposited in the Immune Epitope Database and Analysis Resource (IEDB) database including those derived from Severe acute respiratory syndrome-related coronavirus (SARS CoV) along with de novo prediction from 2019-nCoV 9-mer peptides. Here, we found i) 28 SARS-derived peptides having exact matches in 2019-nCoV proteome previously characterized to be immunogenic by in vitro T cell assays, ii) 22 nCoV peptides having a high sequence similarity with immunogenic peptides but with a greater predicted immunogenicity score, and iii) 44 + 19 nCoV peptides predicted to be immunogenic by the iPred algorithm and 1G4 TCR positional weight matrices respectively.

Results

Identification of 28 exact matches to SARS CoV immunogenic peptides by screening all epitopes deposited in IEDB

We collected all peptides in IEDB (3, as of 13-02-2020) reported positive in T cell assays and have human as the host organism. We then conducted a local sequence alignment of 10 2019-nCoV open reading frames (ORFs) against 35,225 IEDB peptides, and found 28 exact matches. Surprisingly, all identical hits (towards target peptide length > 3) were from SARS-CoV (Table 1, Data Table 14). These peptides have been shown to bind various HLA alleles, although with higher tendency towards HLA-A:02:01, from both class I and class II, and can be target for CD8+ and CD4+ T cells respectively.

Table 1. 28 2019-nCoV peptides having exact matches with immunogenic SARS-CoV peptides.

IEDB.peptide2019-nCoV.patternAntigen.NameAllele.Name
TLACFVLAAVTLACFVLAAVMembrane glycoproteinHLA-A*02:01
AFFGMSRIGMEVTPSGTWAFFGMSRIGMEVTPSGTWN protein
ALNTPKDHIALNTPKDHINucleoproteinHLA-A*02:01
AQFAPSASAFFGMSRAQFAPSASAFFGMSRnucleocapsid proteinHLA class II
AQFAPSASAFFGMSRIGMAQFAPSASAFFGMSRIGMN protein
GMSRIGMEVGMSRIGMEVNucleoproteinHLA-A*02:01
ILLNKHIDAILLNKHIDANucleoproteinHLA-A*02:01
IRQGTDYKHWPQIAQFAIRQGTDYKHWPQIAQFAN protein
KHWPQIAQFAPSASAFFKHWPQIAQFAPSASAFFN protein
LALLLLDRLLALLLLDRLNucleoproteinHLA-A*02:01
LLLDRLNQLLLLDRLNQLNucleoproteinHLA-A*02:01
LLNKHIDAYKTFPPTEPKLLNKHIDAYKTFPPTEPKN protein
LQLPQGTTLLQLPQGTTLNucleoproteinHLA-A*02:01
RRPQGLPNNTASWFTRRPQGLPNNTASWFTnucleocapsid proteinHLA class I
YKTFPPTEPKKDKKKKYKTFPPTEPKKDKKKKN protein
ILLNKHIDILLNKHIDNucleoproteinHLA-A*02:01
MEVTPSGTWLMEVTPSGTWLnucleocapsid proteinHLA-B*40:01
ALNTLVKQLALNTLVKQLS proteinHLA-A*02:01
FIAGLIAIVFIAGLIAIVSpike glycoprotein precursorHLA-A2
LITGRLQSLLITGRLQSLSpike glycoprotein precursorHLA-A2
NLNESLIDLNLNESLIDLS proteinHLA-A*02:01
QALNTLVKQLSSNFGAIQALNTLVKQLSSNFGAIS proteinHLA-DRB1*04:01
RLNEVAKNLRLNEVAKNLSpike glycoprotein precursorHLA-A*02:01
VLNDILSRLVLNDILSRLS proteinHLA-A*02:01
VVFLHVTYVVVFLHVTYVSpike glycoprotein precursorHLA-A*02:01
GAALQIPFAMQMAYRFGAALQIPFAMQMAYRFS proteinHLA-DRA*01:01/DRB1*07:01
MAYRFNGIGVTQNVLYMAYRFNGIGVTQNVLYS proteinHLA-DRB1*04:01
QLIRAAEIRASANLAATKQLIRAAEIRASANLAATKS proteinHLA-DRB1*04:01

*SARS-CoV: Severe acute respiratory syndrome coronavirus

Identification of 22 2019-nCoV peptides with high degree of similarity to previously reported immunogenic viral peptides

In addition to 28 identical hits against SARS CoV, we observed a long tail in distribution of normalized alignment scores between 10 2019-nCoV ORFs and 35,225 IEDB peptides (Figure 1A). We therefore set out to further investigate potential vaccine targets among highly similar sequences.

a8ca9239-c313-40fa-9e10-c07b83a64926_figure1.gif

Figure 1. 2019-nCoV peptides with high sequence similarity to immunogenic peptides in IEDB.

A. Comparison of normalized sequence alignment score for peptides with exact and non-exact matches. B. Number of target peptides grouped by their source organism.

Taking the normalized alignment score of exact matches as a reference, we extracted 2019-nCoV peptides having score greater or equal to 4. As illustrated in Figure 1A, we observed 45 and 11 peptides having normalized alignment score ≥ 4 and ≥ 5 respectively (Figure 1A inset). The target peptides were originated from 10 different sources (Figure 1B) where a total 36 peptides were derived from strains associated to SARS CoV. Of interest, we also observed 7 hits having high sequence similarity to targets from Homo sapiens.

In order to investigate the extent to which the difference between the source (2019-nCoV) and target (IEDB) peptides influences the immunogenicity of the source peptides we used a recently published immunogenicity model5 to predict and compare the immunogenicity between the source and target peptides (Data Table 24).

Table 2. List of 22 2019-nCoV peptides having a higher predicted immunogenicity score than their target peptides.

IEDB.peptide2019-nCoV.patternIEDB.probnCol.prob
WYMWLGARYWYIWLG0.9992490.999441
GLMWLSYFVGLMWLSYFI0.9950730.998216
GLVFLCLQYGIVFMCVEY0.981230.984127
TWLTYHGAIKLDDKDPQFKDNVILLTWLTYTGAIKLDDKDPNFKDQVILL0.9258620.975242
IGMEVTPSGTWLTYHIGMEVTPSGTWLTY0.9035180.919184
GETALALLLLDRLNQGDAALALLLLDRLNQ0.8531140.900655
TPSGTWLTYHGAIKLTPSGTWLTYTGAIKL0.6208940.662417
SIVAYTMSLSIIAYTMSL0.5896940.693763
RRPQGLPNNIASWFTRRPQGLPNNTASWFT0.5332530.584355
YNLKWNYNL-WN0.5202440.765309
AGCLIGAEHVDTSYECDIAGCLIGAEHVNNSYECDI0.5039050.56813
GFMKQYGECLGDINARDLGFIKQYGDCLGDIAARDL0.4719390.506817
ANKEGIVWVATEGALANKDGIIWVATEGAL0.3677230.404796
WNPDDYWNADLY0.3550180.584726
PDDYGGPDDFTG0.3348870.527287
TWLTYHGAIKLDDKDPQFTWLTYTGAIKLDDKDPNF0.270170.529675
DEVNQIDEVRQI0.185040.187797
SSKRFQPFQQFGRDVSNKKFLPFQQFGRDI0.0983840.119472
NHDSPDAELNHTSPDVDL0.0678080.17889
TKQYNVTQAFTKAYNVTQAF0.0548180.171488
VKQMYKTPTLKYFGGFNFVKQIYKTPPIKDFGGFNF0.0186850.135681
QKRTATKQYNVTQAFQKRTATKAYNVTQAF0.0048910.037776

We could see a similar (close to identical) immunogenicity scores for a number of IEDB and 2019-nCov peptides especially for those with high immunogenicity scores (Figure 2). While all 48 can be potential targets, of particular interest were those having higher immunogenicity score than IEDB peptides. Here, we list 22 out of 48 2019-nCoV peptides that scored higher compared to their targets that have been characterized to be immunogenic (Table 2). In this list 15 (68%) 2019-nCov peptides have a score higher than 0.5 whereas only 11(50%) of IEDB get a score immunogenicity score greater than 0.5.

a8ca9239-c313-40fa-9e10-c07b83a64926_figure2.gif

Figure 2. Predicted immunogenicity for IEDB immunogenic vs. 2019-nCoV peptides.

2019-nCoV peptides having a high sequence similarity to immunogenic peptides and their targets were analysed for their immunogenicity potential by iPred algorithm.

It is worth noting that in general predicting immunogenicity of given a peptide is challenging and not a fully solved problem, and therefore current models for predicting immunogenicity are suboptimal. iPred is also not an exception. In fact, we could see that a substantial number of IEDB immunogenic peptides were scored < 0.5 (the threshold score used to classify immunogenic vs non-immunogenic). This led us to ask whether we can gather any other evidence of either immunogenicity or cross-reactivity.

De novo search of immunogenic peptides in 2019-nCoV proteome

As a complementary reciprocal approach, we conducted a de novo search of immunogenic peptides against the 2019-nCov proteome sequence. We scanned 9-mers from 2019-nCoV proteome with a window of 9 amino acids and step length of 1 amino acid (9613 in total). The immunogenicity of 9-mer peptides were predicted using iPred and MHC presentation scores were gauged using NetMHCpan 4.06 for various HLA types. In this task, we focused on haplotypes common in Chinese and European populations, which include HLA-A*02:01, HLA-A*01:01, HLA-B*07:02, HLA-B*40:01 and HLA-C*07:02 alleles (Data Table 34).

Table 3. 2019-nCoV 9-mer peptides predicted to bind 4 different HLA alleles by NetMHCpan 4.0, and those predicted to bind ≥ 3 HLA alleles and immunogenicity score ≥ 0.9 by iPred.

For different alleles, 0 denotes non-binding and 1 denotes binding predicted for specific HLA allele.

Antigen.epitopeImm.probA0101.NBA0201.NBB0702.NBB4001.NBC0702.NBTotal binding HLA
VQMAPISAM0.893938011114
AMYTPHTVL0.862427011114
TLDSKTQSL0.254998111014
KVDGVVQQL0.191786111014
KVDGVDVEL0.18632111014
MADQAMTQM0.991227101013
LEAPFLYLY0.983072100113
RTAPHGHVM0.972153101013
IPFAMQMAY0.961569101013
FLTENLLLY0.951715110013
YLQPRTFLL0.947743110013
MMISAGFSL0.941318011013
ATLPKGIMM0.926603101013

Based on MHC presentation and immunogenicity prediction, we detected 5 peptides predicted to bind 4 different HLA alleles of which 2 had strong immunogenicity scores (Figure 3). For those 65 strong binders to 3 different HLA types, 39 had immunogenicity scores ≥ 0.5 (Table 3). Collectively this analysis suggests a number of 9-mer immunogenic candidates for further experimental validation.

a8ca9239-c313-40fa-9e10-c07b83a64926_figure3.gif

Figure 3. De novo search of 9-mer 2019-nCoV peptides with MHC presentation and immunogenicity potential.

The MHC binding was predicted for HLA-A*02:01, HLA-A*01:01, HLA-B*07:02, HLA-B*40:01 and HLA-C*07:02 alleles by NetMHCpan 4.0 and immunogenicity was predicted by iPred.

Immunogenicity of 2019-nCoV peptides to 1G4 CD8+ TCR molecule

While our de novo candidates are appealing shortlisted targets for experimental validation, it does not provide information about target T cell receptors (TCRs). We therefore set out to interrogate the possibility of cross reactivity with one well-studied TCR.

T cell cross-reactivity has been instrumental for the T cell immunity against both tumor antigens and external pathogens. In that regard, a number of T cells have been extensively characterized including 1G4 CD8+ TCR, which is known to recognize the ‘SLLMWITQC’ peptide presented by HLA-A*02:01. We therefore set out to leverage the data from a recently published study7 and exploit the possibility of cross reactivity of this TCR to any 2019-nCoV peptide.

Here, we scanned all 9-mers from the 2019-nCoV proteome (9613 peptides) with Binding, Activating and Killing Position Weight Matrices (PWM, see the method section) and associated each peptide with the geometric mean of these three assays as a measure of immunogenicity (Data Table 44). The distributions of binding, activation and killing scores along with their multiplicative score and geometric mean are illustrated in Figure 4. Based on geometric mean, we observed 20 2019-nCoV peptides with a score > 0.8 and 516 peptides > 0.7. The 9-mer peptides with geometric mean > 0.7 and positive HLA-A*02:01 binding prediction by NetMHCpan 4.0 are listed in Table 4.

a8ca9239-c313-40fa-9e10-c07b83a64926_figure4.gif

Figure 4. Distribution of 1G4 TCR positional weight matrix scores for 2019-nCoV peptides.

The positional weight matrices were obtained from 7 and 9613 9-mers generated from 10 2019-nCoV ORFs were computed for their TCR recognition potential.

Table 4. 2019-nCoV 9-mer peptides with geometric mean ≥ 0.7 by 1G4 TCR positional weight matrix and predicted positive to bind HLA-A*02:01 by NetMHCpan 4.0 (Rank = NetMHCpan rank)

PeptideBinding scoreActivation scoreKilling scoregeoMeanRankBinder
RIMTWLDMV0.8663774280.8539950.7763030.8312490.3481SB
ALNTLVKQL0.8024537410.750730.7859570.7794130.6159WB
LLLDRLNQL0.8098954140.77520.7410960.7748880.0423SB
MIAQYTSAL0.7662624990.7895110.7494770.7682420.9238WB
VLSTFISAA0.7996724510.7561170.6872780.7462390.536WB
NVLAWLYAA0.7612975520.6861170.7399440.7284231.4457WB
RLANECAQV0.7831617060.7197050.6805040.7265720.2049SB
KLLKSIAAT0.7488966790.7089960.6974630.7181181.0923WB
QLSLPVLQV0.701283760.7152590.7084050.7082930.4768SB
VQMAPISAM0.7293207680.6985140.6896120.7056121.4677WB
LLLTILTSL0.71317090.7151940.6800640.7026230.2712SB
SVLLFLAFV0.7369727620.6908550.6795340.702021.1449WB
LMWLIINLV0.7278473740.6811190.6940070.7007171.304WB

We further analysed the MHC binding propensities and gathered peptides not only predicted positive by NetMHCpan but also to have leucine (L) and valine (V) in anchor positions 2 and 9 respectively. This led to identification of 44 2019-nCoV peptides of which 2 peptides had immunogenicity score > 0.7 and 12 peptides > 0.6 (Table 5). Thus, here we provide the list of peptides that are potential targets for 1G4 TCR recognition for subjects with HLA-A02:01 haplotype.

Table 5. 2019-nCoV 9-mer peptides having leucine-valine in anchor positions.

Peptides have geometric mean ≥ 0.6 and ≤ 0.7 (for those ≥ 0.7, refer to Table 4) by 1G4 TCR positional weight matrix and predicted positive for HLA-A*02:01 binding by NetMHCpan 4.0 (Rank = NetMHCpan rank).

PeptideBinding scoreActivation scoreKilling scoregeoMeanRankBinder
TLMNVLTLV0.7236870.6589860.6521780.6775340.0444SB
QLEMELTPV0.7112910.6510030.6086050.6556251.6769WB
MLAKALRKV0.6687560.6106640.659680.6458540.3524SB
GLFKDCSKV0.6759520.6323750.5947530.6334940.2677SB
ALSKGVHFV0.6525490.6049520.5862360.6139540.0425SB
YLNTLTLAV0.6241470.6108260.5754450.6031190.0453SB

Discussion

In this study we provide a profile of computationally predicted immunogenic peptides from 2019-nCoV for functional validation and potential vaccine developments. We are fully aware that an effective vaccine development will require a very thorough investigation of immune correlates to 2019-nCoV. However, due to the emergency and severity of the outbreak as well as the lack of access to samples from infected subjects, such approaches would not serve the urgency. Therefore, computational prediction is instrumental for guiding biologists towards a quick and cost-effective solution to prevent the spread and ultimately help eliminate the infection from the individuals.

With a rising global concern of novel coronavirus outbreak, numerous research groups have started to investigate and publish their findings. At the time of preparing this manuscript, we became aware of a similar study conducted in comparing 2019-nCoV proteome with SARS CoV immunogenic peptides8. Our in silico approach takes the search beyond presenting only common immunogenic peptide between SARS and 2019-nCoV and provides the experimental community with a more comprehensive list including de novo and cross reactive candidates. On the other hand, considering the fact that two studies have been accomplished independently with distinct approaches, this serves to demonstrate a high level of confidence in reproducing the results. Reproducibility of computational prediction is always of high importance and becomes even more significant under urgent scenarios as of this outbreak.

Our study also suggests the need for further efforts to develop accurate predictive models and algorithms for the characterization of immunogenic peptides.

In this study, we provide potential immunogenic peptides from 2019-nCoV for vaccine targets that i) have been characterized immunogenic by previous studies on SARS CoV, ii) have high degree of similarity with immunogenic SARS CoV peptides and iii) are predicted immunogenic by combination of NetMHCpan and iPred/1G4 TCR positional weight matrices. Given the limited time and resources, our work serves as a guide to save time and cost for further experimental validation.

Method

Data acquisition

2019-nCoV open reading frame sequences were downloaded from NCBI (MN908947.3). All sequences subjected for analysis are deposited in GitHub repository.

Data analysis

All subsequent analyses have been conducted in R 3.6.1.

Sequence similarity comparison

The sequence similarity between 2019-nCoV open reading frames and previously characterized immunogenic peptides in IEDB was analysed by local alignment using R ‘pairwiseAlignment’ function from Biostrings v2.40.2 package. The local alignment utilized BLOSUM62 matrix, gapOpening of 5 and gapExtension of 5. The alignment score was normalized by length of target peptides.

Immunogenicity prediction

We have used iPred5 to predict immunogenicity of each given peptide. Briefly, iPred employs peptides’ length and physicochemical properties of amino acids modelled by sums of ten Kidera factors and associates a score to each peptide reflecting its likelihood of recognition by a T cell.

Predicting presentation by MHCs

In order to predict peptide binding to MHC we used NetMHCpan V46. This version of NetMHCpan that comes with a number of improvements, incorporate both eluted ligand and peptide binding affinity data into a neural network model to predict MHC presentation of each given peptide.

Predicting cross reactivity to 1G4 TCR

To gauge the level of 1G4 TCR cross-reactivity to list of 2019-nCoV virus, we have leveraged the data from a recently published study7. 1G4 or NY-ESO-1-specific TCR is a very well-studied and clinically efficacious TCR which recognize the peptide ‘SLLMWITQC’ presented by HLA-A*02:01. Karapetyan et al. have recently provided data from three experimental assays reflecting Binding, Activating and Killing upon each mutation at each position of all possible 9-mers using these three datasets. In a similar way to the original paper, we trained three Position Weight Matrices named B, A and K respectively from Binding, Activating and Killing assay. We defined the cross-reactivity score of a given 9-mer sequence as the geometric mean of B, A and K.

We then scanned 2019-nCoV virus protein sequence with each of B, A and K PWMs and associated each of 9613 9-mers with a cross reactivity score. At the same we utilized NetMHCpan and associated each 9-mer with its presentation score. Our final list of cross-reactive candidate peptides were those with a cross-reactivity sore >= 0.8 and reported as strong binders from NetMHCpan and have ‘L’ and ‘V’ amino acids at anchor positions. The custom R codes are accessible from GitHub repository (see software availability4).

Software availability

Replication code: https://github.com/ChloeHJ/Vaccine-target-for-2019-nCoV.git

Archived source code at time of publication: http://doi.org/10.5281/zenodo.36769084

License: Creative Commons Attribution 4.0 International

Data availability

Source data

2019-nCoV open reading frame sequences were downloaded from NCBI (MN908947.3).

Underlying data

Zenodo: In silico identification of vaccine targets for 2019-nCoV (Data tables). http://doi.org/10.5281/zenodo.36768869

This project contains the following underlying data:

  • Table1 nCoV peptides having exact match with immunogenic SARS CoV peptides.xlsx (Table of nCoV peptides having exact match with immunogenic SARS CoV peptides)

  • Table2 nCoV peptides with high sequence similarity with immunogenic IEDB peptides.csv (Table of peptides with high sequence similarity with immunogenic IEDB peptides)

  • Table3 de novo search on 9-mer nCoV for immunogenic peptides by NetMHCpan and iPred.csv (Table of results of de novo search on 9-mer nCoV for immunogenic peptides by NetMHCpan and iPred)

  • Table4 de novo search on 9-mer nCoV for immunogenic peptides by NetMHCpan and PWM.xlsx (Table of results of de novo search on 9-mer nCoV for immunogenic peptides by NetMHCpan and PWM)

Data are available under the terms of the Creative Commons Attribution 4.0 International license (CC-BY 4.0).

Comments on this article Comments (0)

Version 2
VERSION 2 PUBLISHED 25 Feb 2020
Comment
Author details Author details
Competing interests
Grant information
Copyright
Download
 
Export To
metrics
Views Downloads
F1000Research - -
PubMed Central
Data from PMC are received and updated monthly.
- -
Citations
CITE
how to cite this article
Lee CH and Koohy H. In silico identification of vaccine targets for 2019-nCoV [version 1; peer review: 2 approved]. F1000Research 2020, 9:145 (https://doi.org/10.12688/f1000research.22507.1)
NOTE: If applicable, it is important to ensure the information in square brackets after the title is included in all citations of this article.
track
receive updates on this article
Track an article to receive email alerts on any updates to this article.

Open Peer Review

Current Reviewer Status: ?
Key to Reviewer Statuses VIEW
ApprovedThe paper is scientifically sound in its current form and only minor, if any, improvements are suggested
Approved with reservations A number of small changes, sometimes more significant revisions are required to address specific details and improve the papers academic merit.
Not approvedFundamental flaws in the paper seriously undermine the findings and conclusions
Version 1
VERSION 1
PUBLISHED 25 Feb 2020
Views
21
Cite
Reviewer Report 31 Mar 2020
Raffaele De Palma, DIMI, Department of Internal Medicine, University of Campania "L Vanvitelli", Genova, Italy;  IBBC (Istituto di Biochimica e Biologia Cellulare), CNR-Napoli, Naples, Italy 
Approved
VIEWS 21
The Authors use an in silico approach to identify antigenic peptides derived from 2019-nCoV. First, they screened ten open reading frame of 2019-nCoV sequence used the IEDB database, finding a series of peptides potentially immunogenic. The first piece of data ... Continue reading
CITE
CITE
HOW TO CITE THIS REPORT
De Palma R. Reviewer Report For: In silico identification of vaccine targets for 2019-nCoV [version 1; peer review: 2 approved]. F1000Research 2020, 9:145 (https://doi.org/10.5256/f1000research.24839.r60502)
NOTE: it is important to ensure the information in square brackets after the title is included in all citations of this article.
Views
42
Cite
Reviewer Report 05 Mar 2020
Katalin Andrea Wilkinson, Tuberculosis Laboratory, The Francis Crick Institute, London, UK;  Institute of Infectious Disease and Molecular Medicine, University of Cape Town, South Africa 
Approved
VIEWS 42
This is an important manuscript identifying potential vaccine targets for 2019-nCoV, using computational prediction. In the absence of patient samples, such approaches are instrumental to guide towards quick and efficient identification of vaccine candidates. The authors used 10 open reading ... Continue reading
CITE
CITE
HOW TO CITE THIS REPORT
Wilkinson KA. Reviewer Report For: In silico identification of vaccine targets for 2019-nCoV [version 1; peer review: 2 approved]. F1000Research 2020, 9:145 (https://doi.org/10.5256/f1000research.24839.r60504)
NOTE: it is important to ensure the information in square brackets after the title is included in all citations of this article.
  • Author Response 07 Apr 2020
    Hashem Koohy, MRC Human Immunology Unit, Medical Research Council (MRC) Human Immunology Unit, MRC Weatherall Institute of Molecular Medicine (WIMM), John Radcliffe Hospital, University of Oxford, Oxford, UK, Oxford, UK
    07 Apr 2020
    Author Response
    Dear Prof Wilkinson,
    Thank you so much for your time and valuable suggestions. In our new and revised version we have taken your suggestions into consideration.
    Best regards
    Hashem Koohy
    Competing Interests: No competing interests were disclosed.
COMMENTS ON THIS REPORT
  • Author Response 07 Apr 2020
    Hashem Koohy, MRC Human Immunology Unit, Medical Research Council (MRC) Human Immunology Unit, MRC Weatherall Institute of Molecular Medicine (WIMM), John Radcliffe Hospital, University of Oxford, Oxford, UK, Oxford, UK
    07 Apr 2020
    Author Response
    Dear Prof Wilkinson,
    Thank you so much for your time and valuable suggestions. In our new and revised version we have taken your suggestions into consideration.
    Best regards
    Hashem Koohy
    Competing Interests: No competing interests were disclosed.

Comments on this article Comments (0)

Version 2
VERSION 2 PUBLISHED 25 Feb 2020
Comment
Alongside their report, reviewers assign a status to the article:
Approved - the paper is scientifically sound in its current form and only minor, if any, improvements are suggested
Approved with reservations - A number of small changes, sometimes more significant revisions are required to address specific details and improve the papers academic merit.
Not approved - fundamental flaws in the paper seriously undermine the findings and conclusions
Sign In
If you've forgotten your password, please enter your email address below and we'll send you instructions on how to reset your password.

The email address should be the one you originally registered with F1000.

Email address not valid, please try again

You registered with F1000 via Google, so we cannot reset your password.

To sign in, please click here.

If you still need help with your Google account password, please click here.

You registered with F1000 via Facebook, so we cannot reset your password.

To sign in, please click here.

If you still need help with your Facebook account password, please click here.

Code not correct, please try again
Email us for further assistance.
Server error, please try again.